SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003068 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003068
Domain Number 1 Region: 613-925
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.02e-72
Family Protein kinases, catalytic subunit 0.000000219
Further Details:      
 
Domain Number 2 Region: 210-285
Classification Level Classification E-value
Superfamily HR1 repeat 1.05e-22
Family HR1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 129-198
Classification Level Classification E-value
Superfamily HR1 repeat 2.35e-22
Family HR1 repeat 0.0000316
Further Details:      
 
Domain Number 4 Region: 17-95
Classification Level Classification E-value
Superfamily HR1 repeat 6.15e-19
Family HR1 repeat 0.0000115
Further Details:      
 
Domain Number 5 Region: 320-344,386-475
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000116
Family PLC-like (P variant) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003068   Gene: ENSMODG00000002524   Transcript: ENSMODT00000003134
Sequence length 944
Comment pep:novel chromosome:BROADO5:3:445828028:445848016:-1 gene:ENSMODG00000002524 transcript:ENSMODT00000003134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDALQSEPGTWSVLEQLGLAGADLAAPGVQQRLELEVERLRREIRKELKLKEGAENLR
RATTDLGRSLGPVELLLRGSTRRLDLLHSQLQELHGLVVLHEPRQAQPQLGQAQDGPQSP
NCPATSLSLVAGLEKQLTIELKVKQGAENMIHTYSNGNTKERKLLLTAQQMLQDSKTKID
IIRMQIRKALQAGQLENQGPEESHGGPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLL
SAAKAPDRKAVSEAQAKLTESSQKLALLRAALELRLGELPAEHPKGRLLLEELAMASSST
FSTRIGPFPATHYSTLCKPSPLTGTLSVRVLGCSGLPETVPWSSPPTSGSSGTSESRPFL
GRPARGLYSRSGSLSGRGSIKTEEPTNEVSAVLKVDNTVVGQTPWKPCGPNAWDQSFTLE
LERARELELSIFWRDHRGLCALKFLKLEDFLDNQRHQVQLELEPQGCLLAEVIFHNPVIE
RIPRLQRQKKVFSKQQGKAFLRARQMNIDIATWVRLLRRLLPSPNSTGTFSPGATTAEGR
TSGDIPIEKLNLDSDSSTQKSPLDLLSSPSSLSSPSSLSPRSQDTPQPSESTPEDRETPG
PTPSSPLRTSPLSLNDFKFLAVLGRGHFGKVLLSEYLPSGELFAVKALKKGDIVARDEVE
SLMCEKRILGRGDGRLPSLLGQPVRLLPDPRARVLRHGVRGGRGPDAAHPSDVFTEPRAV
FYSACVVLGLQFLHDHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTSTFCGT
PEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFL
STEAIGIMRRLLRRNPERRLGSGERDAEDVKKQPFFRTLGWEALLARQLPPPFIPVIKGR
TDISNFDEEFTGEAPALTPPREARPLSAAEQEAFRDFDYVSKGC
Download sequence
Identical sequences F7B8S9
ENSMODP00000003068 ENSMODP00000003068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]