SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003126 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003126
Domain Number 1 Region: 97-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-78
Family Motor proteins 0.000000166
Further Details:      
 
Domain Number 2 Region: 547-862
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-57
Family Motor proteins 0.000000105
Further Details:      
 
Domain Number 3 Region: 1256-1373
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.19e-24
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number 4 Region: 860-984
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.1e-24
Family Myosin rod fragments 0.00000394
Further Details:      
 
Domain Number 5 Region: 1453-1572
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000141
Family Myosin rod fragments 0.0043
Further Details:      
 
Domain Number 6 Region: 1830-1933
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000628
Family Myosin rod fragments 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003126
Domain Number - Region: 1651-1765
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00275
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 1107-1203
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00497
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number - Region: 1374-1487
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00915
Family Myosin rod fragments 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003126   Gene: ENSMODG00000002541   Transcript: ENSMODT00000003192
Sequence length 1947
Comment pep:novel chromosome:BROADO5:1:388381889:388445039:1 gene:ENSMODG00000002541 transcript:ENSMODT00000003192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLRHGQSEAGALISPCSRVAWILCCSSLLVLAPPTFAAMMDLSELGEAAAYLRKSYQE
MVKVHTILGNGKKWVWVPDEQEAYLEAEVKEIKAGRVTVETKDQKILTVREADVQSMNPP
RFDLLEDMSMMTHLNEASVLHNLRHRYAHWMIYTYSGLFCVTINPYKWLPVYTAPVVAAY
KGKRRTEAPPHIYAVADNAYHSMLQNRENQSMLITGESGAGKTVNTKRVIQYFATVAALG
EGPGKKAVRPGTLEDQIIEANPALEAFGNAKTLRNDNSSRFGKFIRIHFGPSGKLASADI
DSCESEGEMAGEGHGGGRRSWWRLAFVHTRTSNKISLPSFKLSFFPALSTARASGWHPEG
LHNLSRGSFAHESQRRDLIPGLPDGGWLGIPWASLPLPSAAMKRTIAGMMGPRELASTHA
LVCQPSIGGSSPGRRAGRGLPEIKLLGLPQYPRRLRKWVNNNDSKAKVKTHGENKRIGGE
YQLLDTPTDKRVCFEGDSVARKGGSHNSLTRQSEHYVEGARWRRTFSCLRVSCAWAPTNL
LPTSPLQPMGILSILEEECMFPKASDVSFRAKLYDNHAGKSPNFQKPRPDKKRKYEAHFE
IVHYAGVVPYSIVGWLEKNKDPLNETVVPVFQKSQNKLLASLYESYAASTSASGQSPPEG
SKSGVKEKRKKAASFQTVSQLHKVRRDALPAPPGTNPHLSWSPASPGGQLLRLAVMFNSS
LCEHHNKSIQILQLPPHSHTPPRYRILNPSAVPDDTFVDSRKATEKLLSSLDIDHTQYKF
GHTKVFFKAGLLAVLEELRDERLAKILTLLQARIRGHLMRIEHQHMRGGRDALYTIQCNI
RAFAAVKNWSWMKLFFKMKPLLRSVQAEEELGALRAEVRGLRGSLAEAEAKRQELEEKHI
SIAQEKNDLSLQLQAEQDNLADAEERCDLLIKSKVQLEAKVKELSERLEDEEETNSDLTA
RKRHLEDECTELKKDIDDLELTLAKVEKEKHATENKVRAHCPELGLRPGPRARNEAKETQ
RNLREERELRLAWIKAENQEKKKNQRKLKGEGSEKRKQRIRLDRAEADHQEGLKQKFRVW
VCSLRLASPALTPQRPWPPLFRGRKDFEMSQLNSRIEDEQVLGAQMQKKIKELQARGEEL
EEELEAERAARARVEKQRAESARELEELSERLEEAGGASAGQREGSRKLEADLGRLRREL
EEATLRHEATAAALRKRQADTAAELGEHIDSLQRARQKLEKEKSELRMEVDDLSANVEAL
TRGKANAEKLCRASEDHLGEAKAKVDELQRQLADATAQRGRLQTENGELSRLLEEKESLI
SQLSRGKTSVTQSLEELRRQLEEETKAKSALAHTVQASRHDCELLREQHEEEAEAQAELQ
RLLSKANAEVAQWRSKYEADAIQRTEELEEAKKKLAARLQEAEEVAEAAHARCSSLEKAK
LRLQTEVDDVSLELERSTSAAAALDKKQRLLERALEERRRQEEETQRELEAAQREARSLG
SELFRLRHSHEEVLEALETLKRENKHLQEEISDLTDQISLSGKNLQELEKVKKSLEGEKS
ELQAALEEAEGALELEETKTLRSQLELSQVKADMDRKLAEKNEESENLRRNHQRTVESLQ
ASLDAEARARNEALRLKKKMEGDLNELELQLGHATRQASEAHAATRLLQAQLKDAQVAQD
EAQRVAGELREQGQALERRNGLLLAELEELRAVLEQGERARRLAEQELLEATERINLLHS
QNTGLVSQKKKLEADVSQLSGEVEEAMQESREAEEKAKKAITDAAMMAEELKKEQDTSAH
LERMKKTLEQTVRELQVRLDEAEQVALRGGKKQVQKLEAKVRELELELDGEQKKNVEAQK
GIRKHERRVKELTYQAEEDRKNLARMQDLIEKLQSKVKSYKRQFEEAEQQANSNLVKYRK
AQHELDDAEERADIAETQVNKLRARTR
Download sequence
Identical sequences F7GF97
ENSMODP00000003126 ENSMODP00000003126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]