SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003163 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003163
Domain Number 1 Region: 130-204
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 4.97e-30
Family AN1-like Zinc finger 0.0000778
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000014
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003163   Gene: ENSMODG00000019428   Transcript: ENSMODT00000003231
Sequence length 209
Comment pep:novel chromosome:BROADO5:1:118791630:118886195:-1 gene:ENSMODG00000019428 transcript:ENSMODT00000003231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDDNVPEAQSTLDSTSSPSMQPSPVSNQSLLSDSVASTQVESTSVDKAVPETDD
LQASVSDTAQQPSEEQNKSLDKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVH
NCSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences F7G4S3
XP_007479348.1.35504 XP_016280457.1.35504 XP_016280459.1.35504 XP_016280462.1.35504 XP_016280463.1.35504 XP_016280465.1.35504 ENSMODP00000003163 ENSMODP00000003163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]