SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003164 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003164
Domain Number 1 Region: 135-208
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 7.98e-31
Family AN1-like Zinc finger 0.0000199
Further Details:      
 
Domain Number 2 Region: 13-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000002
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003164   Gene: ENSMODG00000002603   Transcript: ENSMODT00000003232
Sequence length 213
Comment pep:novel chromosome:BROADO5:6:93885594:93895596:1 gene:ENSMODG00000002603 transcript:ENSMODT00000003232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGSASGSNSPT
SDSASVQRAEASLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEAS
EPVVTQPSPSVSQPSTSRNEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRY
SDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Download sequence
Identical sequences F7G4S0
13616.ENSMODP00000003164 XP_001365007.1.35504 ENSMODP00000003164 ENSMODP00000003164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]