SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003242 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003242
Domain Number 1 Region: 4-281
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.53e-53
Family Crotonase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 328-475
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.89e-33
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 477-583
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 3.23e-22
Family HCDH C-domain-like 0.00068
Further Details:      
 
Domain Number 4 Region: 615-704
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.44e-18
Family HCDH C-domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003242   Gene: ENSMODG00000002671   Transcript: ENSMODT00000003310
Sequence length 722
Comment pep:novel chromosome:BROADO5:2:541137335:541172459:-1 gene:ENSMODG00000002671 transcript:ENSMODT00000003310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYTRLAGSLAVLRIRNPPVNSIGKAVIEDLMEGLRKVKIDPAVKVILCGADGKFSAGA
DIRNFAGPVQMTHSLGSVIDMLEKMEKPLVAAIQDLALGGGLELALGCHYRIADAKARIG
ATEVTLGLIPGARGTQLLPRLIGVPAALDLITSGRHVLAPEALKLGILDKVVNSDPLKEA
IKLAKEVSGRPIGSRRLMTRQVPALPDEDRVFQEALRQIRKKYPGCISREACVRAVQAAV
RHPYPEGCQKEKELFMYLKDSGQCKALLYAFFAERSVRKWSTPSGASWKTSRALPVSVAA
VVGKRSAGSARIQHVEGFWPPSLSPGQDEKQLEQARQAIVALVDKEAVRRKQSGREWSPP
RIGFSTSLAEVAAADLVIEAVYEDMELKKQVFRQLSAQCKPSALLCSNTSALDVDELALA
TRHPAQVVGTHFFSPAHVMPLLEVVPSRYSSPAAIATIMSLAKTIGKVGVVVGNCFGFVG
NRMLTTFREQAHFLVEEGSRPEDVDAALEEFGYRMGPFRVADLAGLDVGWRSRRGQGLTG
PALPLGTPVRHRGSRRYCPLPDLLCEHGRFGQKTGKGWYRYDQAMGRIPQVDPWISKFLS
EYRQRHLIEPRVVKPEEVLERCVYSLINEGFRLLADGMAAGPEHIDVIYNNGYGWPRHKG
GPMFYASTVGLPTVVEKLQKYHQKNLDIPALEPCDLLRKLASQGNPPLREWQSLGGPLMG
KL
Download sequence
Identical sequences F7CYY8
ENSMODP00000003242 13616.ENSMODP00000003242 ENSMODP00000003242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]