SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003246 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003246
Domain Number 1 Region: 949-1022
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.18e-18
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 2 Region: 2053-2120
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.58e-18
Family TB module/8-cys domain 0.00000845
Further Details:      
 
Domain Number 3 Region: 2332-2404
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.89e-18
Family TB module/8-cys domain 0.00048
Further Details:      
 
Domain Number 4 Region: 1847-1974
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.54e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 1531-1626
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.67e-17
Family TB module/8-cys domain 0.0000108
Further Details:      
 
Domain Number 6 Region: 448-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 7 Region: 2443-2573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 652-725
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.01e-16
Family TB module/8-cys domain 0.00084
Further Details:      
 
Domain Number 9 Region: 715-849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.43e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 541-657
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 11 Region: 2128-2259
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.06e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 12 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 13 Region: 1026-1155
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 14 Region: 1316-1451
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.76e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 15 Region: 1685-1751
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 16 Region: 1196-1323
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 17 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000432
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 18 Region: 844-928
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000903
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 19 Region: 2575-2688
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000659
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 20 Region: 1605-1654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000527
Family EGF-type module 0.00046
Further Details:      
 
Domain Number 21 Region: 231-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000643
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 22 Region: 1154-1209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 23 Region: 2008-2056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 24 Region: 1766-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 25 Region: 1972-2018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000268
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 26 Region: 1445-1493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000271
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 27 Region: 1483-1529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000518
Family EGF-type module 0.00018
Further Details:      
 
Domain Number 28 Region: 2407-2451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 29 Region: 2285-2333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 30 Region: 1809-1845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000493
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 31 Region: 1647-1690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003246
Domain Number - Region: 2248-2290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000123
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 150-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0556
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003246   Gene: ENSMODG00000002675   Transcript: ENSMODT00000003314
Sequence length 2871
Comment pep:novel chromosome:BROADO5:1:178542238:178857833:-1 gene:ENSMODG00000002675 transcript:ENSMODT00000003314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGLLELALGFTVLLSSYTSHGAEGNSETGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPTGQISPSCGSRSIQHCN
IRCMNGGSCSDDHCLCQKGYTGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTLVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVTQKCEDIDECATIPGVCD
GGECSNTVSSYFCKCPPGFYTSPDGTRCIDVRQGFCYASLTNGRCNNQLPQQLTKIQCCC
EIGRCWAAGPAMAPEMCPIRATEEFHRLCTLPGIVPGRPDIPLPPIFPPSGPVPPGGPVP
PIIYPSIPRPPLPELPYPSREPRVLPVNITDYCQLYRGLCLNGHCIPTPGSYRCECNKGF
QLDIRGECIDVDECEKNPCVGGECVNTPGSYICQCRVGYQSTLTRTECRDIDECLQNGRI
CNNGRCINTDGSFHCVCNAGFHVASDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST
CYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSG
GSDINECALDPDICPNGICENLRGTYKCICNLGYEVDASGKNCVDINECALNTLLCDNGQ
CRNTPGSFTCTCPKGFVYKPDLKTCEDINECESSPCVNGACKNTLGSFVCECSPESTLDA
TKTICIETIKGTCWQTIVDGRCEININGATLKSQCCSSLGAAWGSPCTPCKIDTICAKGY
SRIKGTQCEDIDECTVFPGVCKNGLCVNTLGSFVCQCPSGMTLDLTGRICLDIRLETCYL
SHEDEECSLPIAGRHRMDACCCSVGAAWGSTECEECPVRNTPEYDALCPRGPGFATRGEV
INGKPFFKDINECKMIPSLCTYGKCRNTIGSFKCRCDNGFALDSEERNCTDIDECRISPD
LCGQGICVNTPGDFTCECFDGYESGFMMMKNCMDIDECQRDPLLCRGGTCLNTEGSYRCE
CPPGHQMAPNISACIDINECDLSVNLCRNGRCVNLIGKYQCACNPGYHSTPDKLFCVDID
ECSIMNGGCDTFCTNSEGSYECSCRQGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPG
EYRCLCFDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGTTG
CTDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGNGIKCTDLDECSNGTHMCNQHAD
CKNTMGSYRCLCKEGYTGDGFTCIDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPST
DGKACEDIDECSLPNICVFGTCHNLPGLFRCECETGYELDRTGGNCTDVNECLDPTTCIS
GNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTSCSNEIGVGVSK
ASCCCSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQG
GKCINTFGSFQCRCPTGYYLNEETRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYM
QVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIP
STDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFY
NDKLLICEDIDECQNGPVCQRNAECINTAGSFRCDCKPGYRFTSTGQCNDRNECQEIPNI
CSHGQCIDTVGSFYCLCHTGFKTNAEQNMCVDINECERDACGNGTCRNTVGSFNCRCNHG
FILSHNNDCIDVDECATGNGNLCRNGQCLNTVGSFQCQCNEGYEVTADGRSCVDINECLA
DPGKCAPGTCQNLDGSYRCICPPGYSLQNDNCEDIDECVEEPEICALGTCSNTPGSFKCL
CPEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELC
PTEPDEAFRQICPYGSGIIVGLDDTRVDMDECKEPDICKYGQCINTDGSYRCECPFGYIL
HGVECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAF
RCVNTYGSYECKCPIGYVLREDRRMCKDENECEEGKHDCAEKQMECKNLIGTYMCICGPG
YQRRPDGEGCIDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPAQDECLDNREGYC
FTEVLQSMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTN
GADIDECKVIHDVCRNGECINERGSYHCNCNTGYTPDITGTACVDLNECNQAPKPCNFIC
KNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHH
TACIDNNECTSEVNLCGAKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQH
GCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPTGFQY
EQFSGGCQDVNECGSAQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRGPEAP
VSGEVDDNSLSPEACYECKINGYPKRGRRRRSVNETDALDAEDQPEMEAPVSLASWDVEK
TAVFVFNVSSISNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFSKK
KPVAGTYSLQISSIPLYKKKELNQLEDKHDKDYLSGELGDNLKMKIQILLH
Download sequence
Identical sequences F7CYW8
XP_001369848.1.35504 ENSMODP00000003246 ENSMODP00000003246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]