SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003373 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003373
Domain Number 1 Region: 211-673
Classification Level Classification E-value
Superfamily Cytochrome P450 4.71e-136
Family Cytochrome P450 0.0000000000303
Further Details:      
 
Domain Number 2 Region: 13-203
Classification Level Classification E-value
Superfamily Cytochrome P450 6.68e-48
Family Cytochrome P450 0.000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003373   Gene: ENSMODG00000002772   Transcript: ENSMODT00000003444
Sequence length 673
Comment pep:novel chromosome:BROADO5:1:70771500:70818447:1 gene:ENSMODG00000002772 transcript:ENSMODT00000003444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILIWNKGYKARRFPPGPIPLPILGNMLQMDSKDLFTFFDKMAEKYGPVFTVYMGLQRI
VVLHGYEAVKEALIDQGDNFLNRAQLPIFEDNFKGQGIFLSNGEKWRQNRRFSLMTLRNF
GMGKRSIEERVQEEAQYLVEELRKTKGQFFDPTFILGCAPCNVICSIVFNNRFNYDDEKF
LRLMSLLNENFRLLNTPWIQLIWNKGYKARRFPPGPIPLPILGNMLQMDSKDLFTFFDKM
AEKYGPVFTVYMGLQRIVVLHGYEAVKEALIDQGDNFLNRAQLPIFEDNFKGQGILSSSG
EKWRQNRRFSLMTLRNFGMGKRSIEERVQEEAQCLVEELRKTKGQFFDPTFILGCAPCNV
ICSIVFNNRFNYDDKKFLRLMSLLNENFRLLNTPWIQLYNMYPSLIKRLPGNHRTINKNV
LEVRNFIMDEVKKHQETLDPNNPQDYIDCFLIKMQQEKLNPQSAFNYQELMATGSNLFSA
GTETTSSTLRYGLLLLMKHPKIQDKVHEEIDRVLGSSRKPSMQDRVKMPYVDAVVHEIQR
YIHLLPFSLPRLAAQDIHFQKYVIPKGTSVFPLLYSVLYDRKAFPNPYEFDPENFLDKSG
NFQKNDHFVPFSLGKRLCLGESLARMEVFLFLTTILQNFTLKPMVEPKELVTTPLRNGIV
NIPSIYKLSLIPR
Download sequence
Identical sequences F6THX6
ENSMODP00000003373 ENSMODP00000003940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]