SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003376 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003376
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.32e-45
Family L-arabinose binding protein-like 0.000000183
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003376
Domain Number - Region: 208-255
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000942
Family TNF receptor-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003376   Gene: ENSMODG00000002773   Transcript: ENSMODT00000003447
Sequence length 885
Comment pep:novel chromosome:BROADO5:4:340035975:340218574:1 gene:ENSMODG00000002773 transcript:ENSMODT00000003447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLYLHSDGWADRYDVTEGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEF
WQHRFQCRLKGFSQENSKYNTTCNSSLTLTTQYVQDSKMGFVINAIYSMAYGLHNMQTAL
CPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGNNY
FDYINVGSWDNGELKMDDDEVWPKKSAIIRSVCSDPCEKGQIKVIRKGEVSCCWTCTPCK
ENEFVFDEYTCKACQLGSWPTEDLTGCDLIPVQYLRWGDPEPIAAVVFSCLGLLATLFVT
AIFIMYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMS
YSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPD
IMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTM
YTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFT
TSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKGRRLAQNKSEIECFTPKES
MGNGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSVHINKKENPNQTAVIKPFSKSTDS
RFGSTTFPESSTKMLYDVSEAEEQYPAQFRPQTPSPVSTVSQPAGSVSRTDDDIPSLHSE
HAQRSSSSQGSLMEQISSVVTRFTANISELNSMMLSTTSPGTMVTTPLCSSYLIPKEMQL
PTTMTTFAEIQPLPSIEVNGGAQPSSKTPPGGGAGKENAPETSAIVKQDLEELVALTPPS
PFRDSVDSGSTSPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL
Download sequence
Identical sequences F6YGN1
ENSMODP00000003376 ENSMODP00000003376 13616.ENSMODP00000003376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]