SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003385 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003385
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 7.19e-43
Family Nip7p homolog, N-terminal domain 0.00000392
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 6.08e-26
Family PUA domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003385   Gene: ENSMODG00000002782   Transcript: ENSMODT00000003456
Sequence length 180
Comment pep:novel chromosome:BROADO5:1:699188186:699190900:1 gene:ENSMODG00000002782 transcript:ENSMODT00000003456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRTLFQKLSKYIGENIQLLVDRPDGTYCFRLHKDRVYYVSEKILKLAVNISR
ENLVSLGTCFGKFTKTQKFRLHITALDYLAPYAKHKVWVKPGAEQSFLYGNHVLKSGLGR
ITENTNQYQGLVVYSMADVPLGFGVAAKSTQDCRKVDPMSIVVFHQADIGEYVRHEDTLI
Download sequence
Identical sequences F6YGD8
XP_001378150.1.35504 ENSMODP00000003385 ENSMODP00000003385 13616.ENSMODP00000003385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]