SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003420 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003420
Domain Number 1 Region: 504-665
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-42
Family MAM domain 0.00041
Further Details:      
 
Domain Number 2 Region: 167-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-30
Family MAM domain 0.0018
Further Details:      
 
Domain Number 3 Region: 337-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-28
Family MAM domain 0.0017
Further Details:      
 
Domain Number 4 Region: 23-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-21
Family MAM domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003420   Gene: ENSMODG00000002812   Transcript: ENSMODT00000003491
Sequence length 686
Comment pep:novel chromosome:BROADO5:6:96492013:96732988:-1 gene:ENSMODG00000002812 transcript:ENSMODT00000003491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWGVLLAVQALQFARAVELPAGSCAFEDSTCGFDSIFTFLPWILNEEGHYIYVDSTFA
KQGEKAVLLSPDLQAEEWSCLRLIYQITTSSPFPSIPSRLNLYIRFEGENFDRLLWSTKE
SSDSWLIASLDLRNSTKKFKILIEGVLGQGTTASIAVFEIKMTTGYCIECDFEENHLCGF
LNRWNPNVNWFVGGGNIRNSHSILPYDHTLKSELGHYMYVDSVYVKHFQEVAQLISPRTT
TPMSGCLSFYYQLQHGNDNVFTLYTRDASGLYEEIWKIDGSMNEAWNLAEVDFSAPYPTE
VIFEVAFNGAKGGYIALDDISFSPVHCQNQTGISFDTTEASCDFEENLCNFYQDKDGPGW
SRVKVKPNMYRAGDHTTGFGYYLLANTKFTSQPGYIGRLYGPSLPGNLQYCLHFYYAIYG
FFKMSDTLSVYIFEENHVVQEKIWSVLESPRGVWLQAEITFKKPMPSKVVFMSWCKSFWD
CGLVALDDITVQLGNCRSTEMLPPPPGECTFEQDECTFTQERRNRSSWHRRRGETPTSYT
GPKGDHTTGVGFYMYIEASNMVYGQKAQLVSTTLRGVIGKHCLTFFYHMYGAGTGLLNVY
LKREGYKEESLLWRRRGEQSITWLRGLVEYSSERQHQIVFEAIRGVSIRSDIAVDDIKFQ
AGPCTEIEDMTQQSSGFSEDLNEIEY
Download sequence
Identical sequences F7EJE2
ENSMODP00000003420 ENSMODP00000003420 XP_001365421.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]