SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003422 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003422
Domain Number 1 Region: 211-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000631
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 2 Region: 278-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003422
Domain Number - Region: 386-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 334-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000172
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number - Region: 35-91
Classification Level Classification E-value
Superfamily Sialidases 0.0111
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003422   Gene: ENSMODG00000002814   Transcript: ENSMODT00000003493
Sequence length 451
Comment pep:novel chromosome:BROADO5:2:476048847:476360303:1 gene:ENSMODG00000002814 transcript:ENSMODT00000003493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTD
NIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTILEIIC
TEEYSTGYMTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLKDFFTITDLRIRL
LRPATGEIFVDEQHLARYFYAISDIKVYGRCKCNLHATVCVFDNNKLSCECEHNTTGPDC
GKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNCECFGHSKRCSYIELLNTVICVS
CKHNTRGQHCELCRLGYFRNASAQLDDENVCIECFCNPFGSIHDRCNGTGFCECKTGTTG
RKCDECLPGNFWHFGCHPNVCDNEFLHCQNGGTCQNNMKCQCPAGYTGILCEKLRCEEAG
SCSSDSGHGARAKSSLILLMALLGMTGPCLF
Download sequence
Identical sequences F7EJD0
ENSMODP00000003422 ENSMODP00000003422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]