SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003423 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003423
Domain Number 1 Region: 2066-2225
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.5e-31
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00071
Further Details:      
 
Domain Number 2 Region: 4201-4251
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 2541-2598
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000301
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 4 Region: 3756-3814
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000249
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 5 Region: 3950-4007
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000249
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 6 Region: 3189-3245
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000262
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 7 Region: 2967-3024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 8 Region: 2231-2270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 2811-2867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000876
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 10 Region: 3893-3950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 11 Region: 3581-3631
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 1417-1458
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 466-528
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000147
Family ATI-like 0.073
Further Details:      
 
Domain Number 14 Region: 2449-2487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 1276-1339
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000213
Family ATI-like 0.031
Further Details:      
 
Domain Number 16 Region: 3410-3458
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 17 Region: 1814-1872
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000311
Family BSTI 0.076
Further Details:      
 
Domain Number 18 Region: 825-885
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000589
Family BSTI 0.032
Further Details:      
 
Domain Number 19 Region: 1569-1606
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 4775-4832
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000121
Family BSTI 0.019
Further Details:      
 
Domain Number 21 Region: 2488-2538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 22 Region: 1458-1493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 1380-1417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 4565-4619
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 25 Region: 2391-2430
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 26 Region: 4723-4769
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000667
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 27 Region: 1496-1534
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000812
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 2930-2986
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000921
Family VWC domain 0.039
Further Details:      
 
Domain Number 29 Region: 3343-3402
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000105
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 30 Region: 1609-1643
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 31 Region: 1753-1792
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 32 Region: 2604-2666
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000343
Family ATI-like 0.016
Further Details:      
 
Domain Number 33 Region: 1699-1750
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000523
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 34 Region: 926-980
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000719
Family BSTI 0.05
Further Details:      
 
Domain Number 35 Region: 4879-4945
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000128
Family ATI-like 0.033
Further Details:      
 
Domain Number 36 Region: 4373-4430
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000155
Family ATI-like 0.017
Further Details:      
 
Domain Number 37 Region: 1909-1967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000471
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 38 Region: 3029-3068
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000051
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 39 Region: 4938-5003
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000565
Family VWC domain 0.053
Further Details:      
 
Domain Number 40 Region: 4633-4682
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000719
Family ATI-like 0.097
Further Details:      
 
Domain Number 41 Region: 3828-3880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000863
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 42 Region: 4007-4066
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000883
Family ATI-like 0.067
Further Details:      
 
Domain Number 43 Region: 4058-4125
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000105
Family Fibronectin type I module 0.072
Further Details:      
 
Domain Number 44 Region: 972-1019
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000178
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number 45 Region: 4109-4155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000228
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 46 Region: 4158-4219
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000387
Family VWC domain 0.045
Further Details:      
 
Domain Number 47 Region: 3073-3117
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000719
Family BSTI 0.031
Further Details:      
 
Domain Number 48 Region: 2867-2932
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000916
Family BSTI 0.086
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003423
Domain Number - Region: 3256-3304
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000121
Family BSTI 0.048
Further Details:      
 
Domain Number - Region: 4262-4314
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000157
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number - Region: 893-922
Classification Level Classification E-value
Superfamily PMP inhibitors 0.000165
Family PMP inhibitors 0.002
Further Details:      
 
Domain Number - Region: 1662-1687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 2761-2808
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000589
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number - Region: 3467-3526
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000638
Family BSTI 0.081
Further Details:      
 
Domain Number - Region: 5012-5102
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00123
Family Gonadodropin/Follitropin 0.0096
Further Details:      
 
Domain Number - Region: 3635-3692
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00213
Family BSTI 0.019
Further Details:      
 
Domain Number - Region: 1965-2029
Classification Level Classification E-value
Superfamily FnI-like domain 0.00241
Family Fibronectin type I module 0.045
Further Details:      
 
Domain Number - Region: 4317-4366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0209
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number - Region: 2703-2752
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0275
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number - Region: 526-566
Classification Level Classification E-value
Superfamily FnI-like domain 0.0303
Family Fibronectin type I module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003423   Gene: ENSMODG00000002813   Transcript: ENSMODT00000003494
Sequence length 5108
Comment pep:novel chromosome:BROADO5:8:214155158:214261216:1 gene:ENSMODG00000002813 transcript:ENSMODT00000003494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPALLCFWAIWAWADGRWCQQTETVQAEEVVTPRQEELVACSSLYHYVHRGWQLDLAR
SRLTSSSTPTLCPVYKPPDIRLVAWNRTVRACCPGWRGPHCTLATISSAGPGTKDHCFAT
WQCQVGPDLLNASVGSLEECCAQPWGRSWWNDSSEHCLTCSSWPVTGNHPSPALLQPSPG
IVGHLRSQRRGLSATCTTWSGFHYRTFDGHHYHFLGRCTYLLAGDAEATWAVYLLPGERC
PRPDHCQPTVRVLMGQDEVLFQGSRVSVNGVPVPEGEPLLQHGLSLQWPGDWSVLSGGLG
VVVRMDRAGSISLTVDHELQGQTRGLCGLYNGRPEDDFLDPDGGQAVLAATFGNSWKSPD
SEPGCLDAMEVAPGCKGSTGDQGAGVGAGVLQAEAQDICHPLLDGVFRECHAQIPPSGFH
DACLFAYCSASGGQAERQEAVCATFASYARDCAQHGIFIPWRTPGFCERLCPGGQLYSDC
VSSCPPSCGAVGEGEEGQCRRECVSGCECPPGLYRDNDLCVPATQCPCYHHRQRYSPGST
VHQLCNPCVCLEGRWHCSQKPCPAECAVGGDGHYVTFDGRSFFFQGVGGCRYNLVQDYLK
GQLLIELEHGACETGSCLRAISVTRGEAYVQLRDSGAVLVGREEVALPWAEPGGLRVHRA
SSTFLLLHGPGVWLLWGVLEPAAYITLEPLYAHRVRGMCGTFTWNQQDDFLTPAGDVESS
VAAFASKFQRSGDSACRLGDTLIPLNPCSTHAQRRPYAEAACAILQGPAFQQCHGLVEQE
PYQLRCLSAVCSCALGHDCLCPVLAAYARHCAQEGVLSPWRNQTLCPVVCPAGQEYQECA
PVCDRRCGELEACGEFVGCVAGCNCPSGLLWDHESQCVPPSLCPCQLGTRHHPPGSITLQ
GCNRCVCQDRGIWNCTAHHCAPEIAFCPGGQIYSPGSCLLTCDSPRVNVSCPRDTSDGCV
CPPGTVLLDEHCVPPELCPCRHSGQLYPPNSTIQEDCNTCVCQGRQWRCTGHPCSGRCHA
SGAPHYVTFDGLAFTFPGTCEYLLVRGVDGSFSVSAQNLPCGTSGLTCTKALTIRLGKTI
VQMLRGRAVTVNGVSVRPPKIYTGPGLSLRQVGLSLLLTARLGFSLLWDGGTRVMVQLDP
QFRGRVAGLCGDFDGDAANDLRSRQGVLEPTAELAAHSWRLSLLCPEPSLGDMPHPCTVN
AHRVGWARARCGVLLQPLFAPCHVEVPPQQHYEWCVYDACGCDSGGDCECLCSAIAAYAE
ECARRGHHMHWRSQDLCPVQCEGGQAYEACGPVCPPTCQHPGAESAWHCQAVPCVEGCFC
PEGTLLHGGVCLEPAACPCEWRGNFFPLGTLLQRDCGNCTCRAGEWSCGEAGSPCEEMLL
QCAEGDVPCQESGYCVPREWLCDNQEDCGDGSDEEGCAPLGCGEGQFSCGDGRCLPSSLL
CDGRDDCGDGADEHGCPCPEGFLPCADGQCLPLAQLCDGHPDCSDGADEESCLGWENCGP
GEVPCLDGTCVGASQLCDGAWDCADGADEGPRYCPSPPLPIPPASTPTGPSMATLETGPT
SPVRSSSPEPPCGQYEFSCGSGECVPRGWHCDHEEDCQDGTDELDCGQPCPPHHMLCALS
LHCIPYQQLCDGTAQCPDGSDESVDACERLPFPTTPNKTGVPCPEYSCPDGHCISFQQVC
NGQPDCKLRPSPEEQGCATWGPWAPWGLCSQTCGAGVQGRSRRCSPSSPPVLQRCVGPEH
QDRACFTTACPEDGVWGDWSPWSECSEPCRGVVARHRVCHPPQNGGRTCATLPGGPHSTL
QTKTCSQDGCPNVTSCPGELVLQPCAPCPLTCADISSQAKCPPEQPCSPGCWCPEGQVLG
MEGRCVWPRQCPCLVEGARYWPGQRVKINCRLCTCQGGRLRRCQLNPDCAVNCGWSSWSP
WAECLGPCGSQSIQWSFRSPNNPSHLGRGQQCRGIYRKARRCQTEPCEECEHQGDTHRVG
ERWRWGTCQVCQCLLNHTVQCSPYCSLGACPQGWMLVEGKGESCCHCIPIGENRTAVPTA
TPSRPPSLQPEPTLPTYPLPAPGDPCYSPLGLSRLPTSSLRASSEHPEHPAWAGRLGSLV
LGLEPQGWSPSEDAYAELHIQPPFLQIDLLRPRNLTGIIIQGAGSSDAYVTSFSLQFSID
GHHWHDYHETLPGILSPPKLFPGNWDDSAPAVRMFGRVVQAQHVRVLPHDFQHSIFMRVE
LLGCDPVSIPMVPPCPGNEFLCANGVCISPEAICNGIGDCGDGSDEEDCATFLSSTVREE
CSHVASCAHPYSSPPGSFPWLALPDHLFTSKLWSLFTTGTEPGLPEGTFPASESPYLSTK
EEPLLEPLTSFPPTAQILQPEIAAVTDLTPHPVSGIDTMLTGSSTPQWPPFPPVLCSPDQ
VPCEFLGCVDPKQVCDGQEDCLDGSDEQHCAKPSPFAVPTATQPTLPALVAVCSPKQLSC
RSGECLPADLRCDLHPDCQDGSDEDGCVDCLLAPWSGWSSCSRSCGLGVTFQRRALLRAP
LLGGGCPQEDFQSRSCFLQACPVPGAWTSWGPWGPCSASCGGGQQGRWRSCTDPPPKNGG
APCPGTAQESLPCGLQPCRGGTDCGPDLVYVSAEQCQQHLVPRCPPSCQDPEAKRNCSTH
CMEGCRCPPGLLLYDGQCLTLSQCPCPVGTEVKLPKESFLLDNCSQCVCEDGDLHCEAGD
CPVPCGWSAWSSWGPSCPFPSPSLCRSPSNPAASSGGAPCEGNGQEVQTCHTDCGTELLA
WTPWSWSSCSQSCSAPGGPPVWRHRSRLCPTSEGVVCPGEPSEEELCSLPPCPVSSVWTP
WAPWSSCSADCDGGIQTRGRRCSGALSGSPECQGPHSQTRDCHTQPCSAHCPEGMVFYSK
EQCQQEGGPCPRLCLAQDPGVECKGTCGPGCTCPPGLFLHNASCMPLSQCPCQLQGQLYP
PGAVASLDSCNNCTCISGEMECSSESCPVACGWSPWTPWSSCSRSCNVGLRRRFRAGTAP
PAAFGGAECEGPSVEAEFCSLQPCRGPGVAWGPWSPCSVPCGGGYRNRTRGKAPQSPIDF
STCGLQPCSGPAPGVCPEGKQWHNCSEGPASCAELNGQEGANGSCHPGCYCPPGTLLLVS
TPSWGIETWGTREHLNRGGEKRGERWPRRGGPINIDYSCFGDPCLPSIYIYISSWLSILS
KKPSLFSLPGSGGWSPWGPWSACSRTCGGGLRSRSRLCDQPVPQGLGDYCEGPHAQGETC
QALPCPVSNCSTIPGADFHACGPPCPRSCDDLAHCVWHCQPGCYCPRGQVLSTDGTACVD
PSYCDCLDLLTGKRHQLGSVLTRPDGCNHCTCMEGKLNCTNLPCPVPGGWCTWSEWTPCT
LPCQGENRARSRTCACSSPRAGGAPCPGEVGEAGTQLQREPCPSLTTCPVDGGWSPWGPW
SSCDACTGESSRRRECTHPPAEIGGRPCPGEYRESQPCQDNSTHCPDCGGGQHLLPCGKP
CPRSCQDLSPGNVCHSGLSDCHPSCGCPLGQLSQDGLCVPHALCRCQYQPKAMGIAENRS
RLAESGVSSWESLEPGETLMGPCDNCTCVEGILQCQEVPSCPGPGGWAPWGPWEACSVSC
GGGEQLRSRACARPPCLGPARQSRTCHTQVCREAGCPAGRLFRECETDEGCPFSCAHVSR
LVDCFSDGCEEGCRCPPGTFQHGSTCLRECPCVLTVSLLQELEAHSPHSRALQPSLGETG
QLLGPGAELDSGQTLRMGCSNCSCVHGQFTCSLMHCPVPGGFTPWSQWGPCSRSCGGMGT
RTRTRKCAHPKPAHGGQDCQGPLQDLEYCLSPDCPEAEGSTVVPATVFPGGWGTWSPWSP
CSQSCTDPAHPALRGRSRHCLANCTGGESTQERPCNLPLCTAMPLCPGSGCTGGNCSWTE
WAPWAPCSRSCGVGQQRRLRAYYPPGPGGHWCPGILTAYQEHRFCNLRACPVAGGWSHWS
PWSWCDRSCGGGRSLRSRSCTRPPPKNGGAPCSGEQHRVRLCNPEPCEKGCPPGMKVISG
AKRCPHHCSDLQEGFVCQDGSVCKQGCRCLEGFLEQDGACVPVGHCECTDAHGYSWAPGS
QHQDDCNNCTCQAGQLSCTTQLCPPPAYCAWSRWSAWSPCSHSCGQGGQQSRFRSSTSGS
WAPECREEQSQSKPCPQPLCPPLCPHGSHLQALGDSWLQGECQQCSCTPEGIICQDIECA
VPGAWTPWSPWSDCPVSCGGADQVRTRACLDPPPQHGGLPCPGPDTQAQPCGQQHCPELP
APCSWQPWGPCSRSCGPGLTSRSSYCPCLPNGRAPSCNGTTPHLDTRACYSGPCQEECMW
TSWSSWTVCSCQVLVQQRYRHQAPGSRGAGQGTPCTRLDGHFRPCHPRNCSEESCEPPFE
FQTCGSPCAGLCATHQHPGLCQDLAPCQPGCYCPKGLLEQAGGCVPPEQCHCLLGPSSGV
GEPQALAPGEHLRLGCKECVCQDGQLQCSSRNCQGLLPLSGWSEWSPCGPCVPLPVLAPT
WQSALREHRPPEGPSPVPADSPLLASEQHRYRICLDPETGKPWAGDSQFCTAPLSQQRLC
PDPEVCRDSCQWETWGSWSPCQISCSGGFRLRWRKARGLAGERCQGPWAQTESCNTAPCP
GESCEARGTVPTADCANQCPRSCVDLWNRVQCLQGPCSPGCRCPPGQLLQDGHCVPIASC
RCGLPSPNATWELGPDGELQLDCHNCTCVNGSLACTPYGCLAFGPWSAWSDCSASCGRGT
RERHQSCLQDSLQGFSCQVQDMKQIEECNSESCSKCPPGQRATPCATSCPRRCSDLQPGT
LCVQLPCQPGCGCPDGQLLQRDRCVPPAECPCTQLSLPWALFLTPEEQAQELPSGTLLVQ
NCTRCICLEGSFNCSSSDCQAECPPGERWHQMVPGEPIPCEKTCQEVYTEDPLQSNCSKG
QTEGCVCQKGHYRSQAGTCVTAAHCECWHHGRFYLPGTEWQEDCEWCRCIDGRSFCTQNC
LPIICAQGETKVRMPESCCPVCQLESLEEPPMSCKLLKELRNITKGSCHLYQVEVSYCSG
YCPSSTNVIPEEPYLQSVCDCCSYLLDPVNPVQILNLHCPGGDTEPVVLPVIHSCQCSAC
QGGDLSKR
Download sequence
Identical sequences F7EJC7
ENSMODP00000003423 ENSMODP00000003423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]