SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003507 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003507
Domain Number 1 Region: 1193-1458
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.0000023
Further Details:      
 
Domain Number 2 Region: 461-723
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-48
Family YWTD domain 0.00000491
Further Details:      
 
Domain Number 3 Region: 1813-2058
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-46
Family YWTD domain 0.0000152
Further Details:      
 
Domain Number 4 Region: 1508-1765
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-42
Family YWTD domain 0.000023
Further Details:      
 
Domain Number 5 Region: 2948-3203
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-40
Family YWTD domain 0.0000175
Further Details:      
 
Domain Number 6 Region: 137-380
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-40
Family YWTD domain 0.0000511
Further Details:      
 
Domain Number 7 Region: 2122-2389
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-31
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 8 Region: 3824-4101
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-30
Family YWTD domain 0.0000899
Further Details:      
 
Domain Number 9 Region: 2859-2940,3196-3257
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1097-1185,1459-1503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000267
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 3688-3730
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 808-853
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 13 Region: 3525-3562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 851-890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 3564-3600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 2823-2864
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 2692-2728
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 937-973
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.00022
Further Details:      
 
Domain Number 19 Region: 3285-3329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 3407-3443
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 21 Region: 773-812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00043
Further Details:      
 
Domain Number 22 Region: 3486-3520
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 2735-2769
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 3606-3650
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2478-2519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 26 Region: 3442-3482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 27 Region: 3248-3283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 2613-2649
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 29 Region: 3368-3404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 985-1021
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000106
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 31 Region: 2519-2558
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 32 Region: 3327-3364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 33 Region: 2652-2689
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 3729-3848,4097-4150
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 35 Region: 86-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000385
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 36 Region: 1767-1817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000489
Family EGF-type module 0.013
Further Details:      
 
Domain Number 37 Region: 2772-2812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 38 Region: 2572-2608
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 896-936
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 40 Region: 2443-2480
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 41 Region: 1032-1064
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 42 Region: 1067-1103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 43 Region: 7-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 44 Region: 39-126,399-447
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 45 Region: 2077-2126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000027
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 46 Region: 3652-3684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000484
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 47 Region: 729-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family EGF-type module 0.021
Further Details:      
 
Domain Number 48 Region: 4321-4361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.04
Further Details:      
 
Domain Number 49 Region: 4222-4256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000432
Family EGF-type module 0.026
Further Details:      
 
Domain Number 50 Region: 4185-4221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000518
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003507
Domain Number - Region: 4148-4184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000187
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4258-4290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0286
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 2400-2440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.035
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003507   Gene: ENSMODG00000002847   Transcript: ENSMODT00000003584
Sequence length 4532
Comment pep:novel chromosome:BROADO5:4:138921199:140616672:-1 gene:ENSMODG00000002847 transcript:ENSMODT00000003584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEEIEFKCPLNHIACLGTNTCIHLSQLCNGVFDCSDGYDEGVHCRDLLPNCQQMNCQYKC
AITRNGTGCYCQDGYEITEDGRSCKDQDECAVYGTCSQTCINTYGSYVCSCVEGYLMQVD
NKSCKAKNEPSDKPPVLLIANYETIEILYLNGSKVAALSSGKGKEIHTLDFIYNEGRVCW
IESRESSNQLKCTQITKTGRLTDEWIINILPSLHNVQQMAIDWLTGNFYFVDHVSDRIFV
CNRNGSVCVTLIDLELHNPKAIAVDPVSGKLFFTDYGNVAKVERCDMDGMNRTRIVDSKT
EQPAALALDLVSKLVYWVDLYLDYVEVVDYQGKNRHTIIQGIQVRHLYGITIFENYLYAT
NLDNFNIIRINRFNGTDVHALVKMENARAIRIYQKRTQSTVRSHACEVDPYGMPGGCSHI
CLLSSNYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDLNTKIADEYM
IPIENLVNPRALDFHAEANYIYFADTTSFLIGRQKIDGTERETILKDDLDNVEGIAVDWI
GNNLYWTNDGHKKTISVARLQKASQSRKTLLEGEMSHPRGIVVDPVNGWMYWTDWEEDEI
DDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDSHTNTLYWCDAYYDHIEKVFLNGTNR
KVVYSGKELNHPFGLSHHGNYVFWTDYMNGSIFQLDLMTSEVTLLRQERPPLFGLQIYDP
RKQQGNNACRVNNGGCGTLCLAIPGGRVCACADNQLLDENGTTCIFSPGEALPHLCKPGE
FRCRNRRCIQDRWKCDGDDDCLDGTDEDSVNCFNHSCPDDQFKCQNNRCIPKRWLCDGAN
DCGGNEDESNQTCAARTCQVDQFSCGNGRCIPRAWLCDREDDCGDQTDEMISCEFPTCEP
LTQFICKNGRCISSKWHCDSGKDDDCGDGSDEVGCIHSCSDNQFRCSSGRCIPGHWTCDG
DNDCGDFSDETKANCTKEEIRSPAGCNGNEFQCDPDGNCVPDLWRCDGEKDCEDGSDEKG
CNGTMRLCDEKTKFSCKSTGRCINKAWVCDGDIDCEDQSDEDDCESFLCGPPKYPCANDT
SICLQPEKLCNGRRDCSDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCSCPTGLQLNP
DNKTCEIVDYCSKHLKCSQVCEQHKHSVKCSCYEGWKLDMDGESCTSIDPFEAFIIFSIR
HEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESGGVGAIE
VVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGTLRTTLIAGAMEHPRAIALDP
RYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWTDARSD
AIYSALYDGTGMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQNVSVIQ
KTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAACACPHLMKLSPDKK
TCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTDIKT
QTIKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQINVARLDGSLKTS
VIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKDPVGLSIDYVENKL
YWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLGTCSKRD
GRNPTVLRNKTSGVVHMKVYDKEAQRGSNSCQLNNGGCSQLCLPTSETTRTCMCTVGYNL
RKNRMSCQGIESFLMYSVHEGIRGIPLEPTDKMDALMPISGTSFAVGIDFHAENDTIYWT
DMGFNKISRAKRDQTWKEDIVTNGLGRVEGIAVDWIAGNIYWTDHGFNLIEVARLNGSFR
YVIISQGLDQPRSLAVHPEKGYLFWTEWGQNPCIGKARLDGSEKVVLVSMGIAWPNGVSI
DYEENKLYWCDARIDKIERIDLESGGNREIVLSGSNVDMFSVAVFGAYIYWSDRAHANGS
IRRGHKNDATDAVTMRTGLGVNLKEVKVFNRVREKGTNVCAKDNGGCQQLCLYRGNSQRT
CACAHGYLADDGITCLRHEGYLLYSGRTILKSIHLSDETNLNSPVRPYENSNYFKNVIAL
AFDYSLRRKGTNRIFYSDAHFGNIQLIKDNWEGRQVIVENVGSVEGLAYHRAWDTLYWTS
STASSITRHTVDQNRPGAFNREAVITMSEDDHPHVLALDECQNLMFWTNWNEQHPSIMRS
TLTGKNAHVVVSTDILTPNGLTIDHSAEKLYFSDGSLGKIERCEYDGSKRYVIVKSGPGT
FLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKVLRSDIPHQPMGIIAVANDTNSCELSP
CALANGGCHDLCLLTPDGRVNCSCRGDRILLDDNRCVTKNSSCNIYAEFECGNGECIDYQ
LTCDGIVHCKDKSDEKLLYCENRSCRRGFKHCYNRRCIPNSKLCDGEDDCGDSSDELECK
VSTCAAIEFRCADGTCIPKSARCNQNTDCADASDEKNCSNTDCTHFYKLGVKSTGFIQCN
STSLCILPAWICDGSNDCGDYSDELKCPVQSKPKCEENYFGCPSGRCILNTWICDGQKDC
EDGVDEFHCDSSCSWNQFPCSTQKCISKQWICDGEDDCGDGLDESDSICGAITCAADMFS
CLGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCHNKVCIPKQFVCDHD
DDCGDGSDESLECGYRQCSPEEFSCADGRCLLNSQWQCDGDFDCPDHSDEAPLNAKCKSA
EQSCNSSFFMCKNGRCIPSGGLCDSKDDCGDGSDERNCHINECLSKKVSGCSQDCQDLPV
GYKCKCWPGFQLKDDGKTCVDMDECSSGFPCSQQCINTYGTYKCLCTDGYEIQPDNPTGC
KSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYWIDSSRPNG
SRINRMYLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPTILVSK
RLRFPRDISLDPRAGYLYWIDCCEYPHIGRVGMDGTDQSVVIETKISRPMALTIDYVNSR
LYWADENHIEFSNMDGSHRYKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRAHKTSGAD
RLSLINSWHTITDIQVYHSYRQPDVAKHVCMLNNGGCSHLCLLAPGRSHTCACPTNFYLA
ADNKTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQPGRFQCGTG
LCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPINLRCNGQDDCGDEED
ERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHEFQCKNNN
CIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDYDCADGSDER
NCESGCSKDQFQCANGQCISAKWKCDGHEDCKFGDDEKNCEPASPTCSSSEYVCASGGCI
SASLRCNGEYDCADGSDEMDCVTECKEHQFRCKNKAHCIPIRWLCDGIHDCVDGSDEDHC
DRGGNICRADEYLCNNSLCKLHFWVCDGEDDCGDNSDEVPEMCAKFPCPPTRPYRCRNNR
VCLRPEQICNGIDDCGDNSDEDHCGDKLTYKTRPCKKDEFACSDKKCIPTELQCDRFDDC
GDGSDEQGCRIVPTEYTCEDNVNPCGDDAYCNQTQTSVFCRCKPGFQRNMRNRQCEDLNE
CLVFGACSQQCVNMKGSYKCVCDQNYKEKNNTCTAKGSEDQVLYISNDTDILGFIYPFNY
SGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRVHGRERRQTTSGLICPE
FKRPRDIAVDWIAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNCTRLLTNMAG
EPYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNLQRPTGLAVDQFSQRIYW
ADFELSVIGSVLFDGSDSVVSVSSKQGLLHPHRIDIFEDYIYGAGPKTGVFRVHKFGHGS
VEYLSLNVDKTKGALISHRYKQQDLPNPCLDLTCEFLCLLNPSGATCVCPEGKSLINGTC
NDESLLDDSCKLTCENGGRCIINEKGDLRCHCWPSYSGERCEINHCTNYCQNGGTCIAST
LGRPTCSCALGFTGPNCNQMVCERFCQNGGSCSVTAGNQPYCQCMPEYTGDRCQYYVCHH
YCVNSESCTIADDGSVECVCPTRYEGTKCEVDKCLRCHGGHCIINKDSEDITCNCTNGKI
ASSCQLCDGYCYNGGTCQLDPETNIPVCLCSANWSGTQCERPAPKSSKSDHISTRSIAII
VPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYNMYEVDHDHNDG
SLLDPDFIVDPAKARYIGGGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYM
DGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences F7B627
ENSMODP00000003507 13616.ENSMODP00000003507 ENSMODP00000003507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]