SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003532 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003532
Domain Number 1 Region: 2-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003532   Gene: ENSMODG00000024897   Transcript: ENSMODT00000003609
Sequence length 40
Comment pep:novel chromosome:BROADO5:4:140972548:140972667:-1 gene:ENSMODG00000024897 transcript:ENSMODT00000003609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESIDT
Download sequence
Identical sequences F6PNJ9
ENSMODP00000003532 13616.ENSMODP00000003532 ENSMODP00000003532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]