SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003585 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003585
Domain Number 1 Region: 357-521,549-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.08e-24
Family Laminin G-like module 0.069
Further Details:      
 
Domain Number 2 Region: 169-276
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000528
Family Cadherin 0.0053
Further Details:      
 
Domain Number 3 Region: 57-181
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000471
Family Cadherin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003585   Gene: ENSMODG00000002944   Transcript: ENSMODT00000003663
Sequence length 991
Comment pep:novel chromosome:BROADO5:4:371894133:372015565:1 gene:ENSMODG00000002944 transcript:ENSMODT00000003663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPQQPPPPESRQPQQRSHRRSPPAASSWLVTATALLGLCGGGWAARVNKHKPWIETTYH
GIVTENDNTVLLDPPLIALDKDAPLHYAESFEVTVTKEGEICGFKIHGQNVPFDAVVVDK
STGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGANSKKSHKATVHIQVNDVNEYAPI
FKEKSYKATVIEGKKYDNILKVEAVDADCSPQFSQICSYEIVTPDVPFIIDKDGYIKNTE
KLSYGKESQYKLTVTAYDCGKKRATEDVLVKISIKPTCKPGWQGWNKRIEYEPGTGSLAL
FPNIHLETCDEPITSIQATVELETSHIGKGCDRDTYSEKSLHRLCGASSGTAELLPPPSS
TLNWTVGLPTDNGHDSDQVFEFNGTQAVKIPEGVVTVNLKEPFMISVWMRHGPGGRDKET
ILCNSDKTDMNRHHYSLYVHNCRLVFLFRQDPSEEKNYKPAEFHWKLNQVCDKEWHHYVL
NVEFPSVTLYVDGVSYDPFPVTEDYPLHPSKIETQLVVGACWQEYSGNENDNETEAEAVT
VTSAGGELHMAQFFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDLQVTDSKGMKVQANP
SQSVLTLEGDDIEQFEKAMQHISYLNSRQFPTPGIRRLQITSTIKCFSEDACMSVPLVDG
YVMVLQPEEPKISLSGINHFARAASEFESAEGVSLFPELRIISTITREVEQDADGDEEPT
VQESLVSEEIMHNLDTCEITVLGQELNQDEESLEVDTARLQQKGIEMSSSSVGVIITGVD
TMASYEELLHLVRYRNWHASASGLDRKFKLVCSELNGRYVSNEFKVEVSVIHTANPVEHA
NHMAAQPQFVHPVHHSFVDLSGHNLANPHPFSVVPSTATVVIVVCVSFLVFMIILGVFRI
RAAHQRTMRDQDSGKENEMDWDDSALTITVNPMETYEDQHSSEEEEEEEEEEESEDGEEE
DDITSAESESSEEEEGEPEEDQSSNPASDTK
Download sequence
Identical sequences F6PKA0
ENSMODP00000003585 ENSMODP00000003585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]