SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003599 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003599
Domain Number 1 Region: 345-429
Classification Level Classification E-value
Superfamily DEATH domain 0.000000942
Family DEATH domain, DD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003599   Gene: ENSMODG00000002959   Transcript: ENSMODT00000003678
Sequence length 449
Comment pep:novel chromosome:BROADO5:7:74169518:74291268:-1 gene:ENSMODG00000002959 transcript:ENSMODT00000003678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHVRDYKWTHFLPFLVVSLMYPANAEYSNCGENEYYNQTTGMCHDCPQCEPGEEPYMTC
GYGTKDDDYGCVPCPSEKFSKGGYQICRRHRDCEGFFRATVLTPGDMENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSASLPGTSGTSTSSPFQHAHKADLS
GQGHLATALIIAMSTIFIMAIAIVLIIMFYIMKTKPSAQACCTSHSGKTVEAQVSKQEEK
KEVQENVVIFAEKDEFEKLTATPAKTAKSENDASSENEQLLSRSMDSDEEAAVDKQGSPE
LCLLSLVHLTRDKSSTNNKSTGIQSRRKKILDVYANVCGVAEGLSPTELPFDCLEKTSRM
LSSTYNTEKAIVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIE
RLDAVESLCADILEWAQVMPPTPQPPVTT
Download sequence
Identical sequences F6PJS4
ENSMODP00000003599 ENSMODP00000003599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]