SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003600 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003600
Domain Number 1 Region: 15-156
Classification Level Classification E-value
Superfamily EF-hand 6.14e-29
Family Calmodulin-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003600   Gene: ENSMODG00000002963   Transcript: ENSMODT00000003680
Sequence length 163
Comment pep:novel chromosome:BROADO5:1:226055996:226253954:1 gene:ENSMODG00000002963 transcript:ENSMODT00000003680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYSETGAWCPGLEVRPSDRRKWLKVFEACDEDKKGYLSREDFKVAVVMLFGYKPTKIEA
DSVMTSVKPNTSGIYLEDFINLMQKKKAVQLHHNEIRQIFTAFDMQYRGFLTLEDFRKAF
RQVAPKLPERIVLEAFREVDQDSDGHVSFKDFEYAMNYGQNEE
Download sequence
Identical sequences F6Q5F7
ENSMODP00000003600 ENSMODP00000003600 XP_001371999.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]