SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003605 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003605
Domain Number 1 Region: 66-394
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.9e-76
Family Ankyrin repeat 0.0000103
Further Details:      
 
Domain Number 2 Region: 413-512
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-18
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003605   Gene: ENSMODG00000002967   Transcript: ENSMODT00000003685
Sequence length 523
Comment pep:novel chromosome:BROADO5:3:50904829:50989382:1 gene:ENSMODG00000002967 transcript:ENSMODT00000003685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAEVTSEPGTPEKGRLEGVMQGLSDHLRTTLAWSWKGLSKTAKEDAWEKEALVRHDIL
LPNERSFHAAAKRNNLDIMEQLVEKKVNINAMNSMKRTALHFAVGGNHLSAVEFLLNHKA
RVDIADKHGLTVLHLAAWFGSLEIMLMLVKAGADQKAKNQDGMTILHFAAQNNNVRIVDY
LIQDLHLRELNQQDEKGRKPFLLAAERGHVEMIEKLIELNLLTSEKDKEGNTALHLAAKH
GHTSIVEMLITQWQEINQPNEDGETPFFLAVAGGYKEGSKLLLDAGSDINIPNKNNINAL
QIAIQNGHTSLVMFLLSEDIVLDQKAEQDSPLHLAIANNHVTLVSRLLGAKHNVDALNQK
QQTPLHLAADLGNVELVETLLKTGCDLKAVDKDHKEKNYDSPIGPALTFKQDHSLETKQI
RSSLWKLAYHQLKAQEWRKLARSWEFLDEQIKAIEEQWSGSKSSCEHGHRMLLIWLHGIL
MRRENPERRLYEDLVKAGFPELAEKIRQLQSSTDASSKRCAVS
Download sequence
Identical sequences F6Q5C2
ENSMODP00000003605 ENSMODP00000003605 XP_007486602.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]