SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003625 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003625
Domain Number 1 Region: 462-575
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 118-240
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000249
Family Cadherin 0.0067
Further Details:      
 
Domain Number 3 Region: 348-458
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000366
Family Cadherin 0.014
Further Details:      
 
Domain Number 4 Region: 569-686
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000694
Family Cadherin 0.0086
Further Details:      
 
Domain Number 5 Region: 260-355
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000542
Family Cadherin 0.0073
Further Details:      
 
Domain Number 6 Region: 78-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000157
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003625   Gene: ENSMODG00000002985   Transcript: ENSMODT00000003707
Sequence length 857
Comment pep:novel chromosome:BROADO5:6:215882805:215999391:-1 gene:ENSMODG00000002985 transcript:ENSMODT00000003707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLFAHFIVLLVAASGCLAFLNLTVERARPLLENASENTLVAIITAAVSRHDSLVGDPVI
INSNPVVHPFVVSHKAADQWELIMTKEPKLDFEMVAFYTLVIFAQDSGDNSASQTILIQI
VDVNEPPTFIGSLAQVDQVTEIYIPEDTAVGTVLYKVRAKDPENAALKYLISPEDSGFTI
DSIGTISTTMTFDFDRGAKSYSLVIKVADPGELFIVGNLKIFLINVNNKVPILTCSLFNI
REAVLTPSLVNSTTSKEGNISLDEETPLGKTVGVCQATDEDQMGRLIFKLDPGNRYFAID
KERGTVMITNRLDLEEADFVSVQFFTIKACDEDQHCAAIPVMVYIHGINDNPPFCDKYLY
RYRGMEVIANKTVVAKLACHDLDKSPDILQYAPHSGPLGDGELFEQVPDLDNVIWVTKDL
DYEKPEASAVGHAYEMMVSVFDDIRPSHTVTVTIIVEIIPANEFTPVFRPASYSFSVPET
SGASYEVGRVTAFDEDNPLNCVRYKISQGDTQIIRRFWIHPLTGMIELTTQPDYESVKQY
NLTIEAVDCDQVQPRTAVTTVTIDIKDENDEAPVCKPSKYKAVIFDSVAAGTNINSFRLN
CHDRDSRNTEMRFEIVSGNENQHFGFDPTRGSNVPKLIVKNPFNKSGIGAEFYQYYHLVV
HVIDDNLQHGQAVYPRTGTVMIDISVIQQNTPAPPVTSFEQRKGVTIVYTSINTYSPNDW
YIPFIFTLMAVFLTGLLSWTCYLLMKYTRITAWCQKLTKNLSKPKQKGKKYIAGNKNIND
DMVTGNRHKKVEVLTETTVYETVFDGEAIDPVSGNVYEYNSKSGARKWKKMPRPLKDLEA
NIQSISEKLPIDEPIQG
Download sequence
Identical sequences F6Q4W2
ENSMODP00000003625 XP_007500082.1.35504 ENSMODP00000003625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]