SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003638 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000003638
Domain Number - Region: 161-339
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0392
Family Type II DNA topoisomerase 0.031
Further Details:      
 
Domain Number - Region: 324-377
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0654
Family V-type ATPase subunit E 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003638   Gene: ENSMODG00000002994   Transcript: ENSMODT00000003720
Sequence length 572
Comment pep:novel chromosome:BROADO5:3:50994579:51065591:-1 gene:ENSMODG00000002994 transcript:ENSMODT00000003720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDEEKPLVAAREPDPDSSVSSDLQTEYEELLRYAVVTPKSDTIASRQSHSKLLGGTDD
KILNAEEPHASGKGPTGREHRIEPGRNKEISGSSSISKEEVPSFSPSKRPSHPIMDFFSS
QHFNDTSSPGTSSPKEKECCEKVVTESFITDENLRKIESIIELWCSGLKKNVLAELSKWK
LNFIDWHRGEMKKEKDKSATQLEKLQNQVDDLTELQQTYETSAGRKDEVISTLTEASNKQ
KERADVLKIFFHWRIEQLKAKQEIYEAKLADQHYNRALMKRVWKAWRSVLQSQWKNTFER
ACQTRAEEICLQISRDYETQIVSLNDALEAAKTEIQKLQYEKDHYQESLKKAFMRGVCAL
NLEALSIFQSRHDNGIESTNKKDDYGPGDSGKDGPLHFDPSLLSVPSQVPSHLHSQVPSQ
VTSHLHSQVPSQELSAPGLVLNPSGASAPVLSLGHLSSANLRAKQKLYLPKVVTSVQQKA
GRTITARIAGRSDLPLKASRNCGGLAIMGVLPPMSSVVIEKHHPVTQQTIPQALAAKYPR
TVHYETSSTSSRHPGHGGKASAQSCHSIKVVD
Download sequence
Identical sequences F6Q4B0
ENSMODP00000003638 ENSMODP00000003638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]