SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003703 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003703
Domain Number 1 Region: 1-416
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.51e-117
Family L-arabinose binding protein-like 0.0000855
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003703
Domain Number - Region: 424-471
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0612
Family TNF receptor-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003703   Gene: ENSMODG00000003048   Transcript: ENSMODT00000003786
Sequence length 753
Comment pep:known chromosome:BROADO5:3:500714366:500730481:1 gene:ENSMODG00000003048 transcript:ENSMODT00000003786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRFAVEEINRDPVLLPNVSLGFQVYNAYHSDERTLESSLQWLTGESQPVPNYSCREQDKI
VAIIGGATSALSVQMGTLLELYNFPQLSFGPFDLILTDKVQFPSLYQMAPKDYSLQQGVA
RLLAYFKWTWVGLVTTDDLRGEEFLREMTGRMEKYGICAAFTEKIPVSERIHEESKVNFM
PRIMESSARAVVIHGDTDSLMVLRHSQIPFIPMYKIWITTSHWDITMRPKYVDNYNFYGA
LTFTYLTSEVPGFKSFLKTVHPSKDPKDTVLRDFWFSAFQCQKQCTPNETLESLPIYLFD
TTMSGLSYTIYNAVYAVAWALHEELLRKSETAPEEAGESGVPHPWQLHSFLKDIQFHNSA
GDQVFMDEKRRSEAQYDIRNYVTSLNDTEFLVKVGQFLPNTQPGQDFIMHEEDINWGWLD
TKIPHSVCSASCAPGYRKITKEGEPICCFSCSQCPEGEISKQTDMDQCAKCPEDEHPNKE
RDHCFPKVVTFLDFTGSLGTALTFVAASFSLLTALVLWVFVKFRDTPIVKANNRALSYTL
LVSLSFCFLCSLLFIGRPTAATCLLRQTTFGVVFTVAVACILAKTIMVVLAFRVTRPGSS
IRVWVQSRVSNCIVLVCSGIQVMLCGFWLGTSPPFPDMDLHSEPGHIIIQCNEGSDIAFY
CVLGYMGFLALGSFTVAFLARSLPDTFNEAKFITFSMLVFCSVWVSFLPTYQSTKGQAMV
VVEIFSILASGAGLLGCIFLPKCYVILLRPERN
Download sequence
Identical sequences F6PP39
ENSMODP00000003703 ENSMODP00000003703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]