SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003844 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003844
Domain Number 1 Region: 292-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-42
Family SPRY domain 0.0000968
Further Details:      
 
Domain Number 2 Region: 8-75
Classification Level Classification E-value
Superfamily RING/U-box 1.33e-17
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 3 Region: 93-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.16e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003844   Gene: ENSMODG00000025022   Transcript: ENSMODT00000003930
Sequence length 453
Comment pep:novel chromosome:BROADO5:5:100735829:100741124:1 gene:ENSMODG00000025022 transcript:ENSMODT00000003930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKELIENLKAELTCSICLGYFTDPVTALKCGHNFCKDCLLQCNEQADATLTCPECRAV
IRYSDIVLNENLQNLSITGKTLRRHLLLSPALLTTCDQHGEKEKLFCEQDQKPICDSCLL
TQEHKDHQILPLKMAVDKYKKKLQETRNMLQEKEEEFKKAMDEFIELDKALKRDSDYFQQ
LIRSEYKKMHKFLCNEEEKHIEQLTREITNNQDRLVEKKTEFSKQIQCLQRKILQIEEGL
YKAPLKMVEQEVQALSKEHEEKEMEKPDFIWKSHRMTGLIEILRSYESESKYTFLMDILL
DPERDSLHLIVPERFKQLKSELDLQDQPDKEERLDYFVTVLGDQTFSSGKHYWEVDVEDQ
TEWVLGICEDSVSKNENVSILSEDVRSMIGSKVNDEILFWSPQRCFVSIPTPKVGVFLNY
EEGEVSFYDIEDKSILLRAPNSAFRGPIRPFFS
Download sequence
Identical sequences F6WE21
ENSMODP00000003844 ENSMODP00000003844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]