SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003852 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003852
Domain Number 1 Region: 3821-4002
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-34
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 1554-1690
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 3125-3236
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 3335-3446
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-29
Family Cadherin 0.00049
Further Details:      
 
Domain Number 5 Region: 1141-1246
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-28
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 3229-3334
Classification Level Classification E-value
Superfamily Cadherin-like 2e-28
Family Cadherin 0.00077
Further Details:      
 
Domain Number 7 Region: 2280-2386
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-28
Family Cadherin 0.00078
Further Details:      
 
Domain Number 8 Region: 1029-1147
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 2808-2916
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-27
Family Cadherin 0.00078
Further Details:      
 
Domain Number 10 Region: 930-1033
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 3023-3131
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 12 Region: 146-269
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 13 Region: 1763-1883
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 14 Region: 466-568
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 15 Region: 819-922
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-24
Family Cadherin 0.00069
Further Details:      
 
Domain Number 16 Region: 1454-1558
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-23
Family Cadherin 0.00062
Further Details:      
 
Domain Number 17 Region: 2588-2725
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-23
Family Cadherin 0.0038
Further Details:      
 
Domain Number 18 Region: 2917-3022
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-22
Family Cadherin 0.0024
Further Details:      
 
Domain Number 19 Region: 1871-1996
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 20 Region: 2072-2179
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-21
Family Cadherin 0.003
Further Details:      
 
Domain Number 21 Region: 733-823
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 22 Region: 1666-1769
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 23 Region: 2490-2600
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-21
Family Cadherin 0.0028
Further Details:      
 
Domain Number 24 Region: 1242-1357
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 25 Region: 2388-2487
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 26 Region: 2180-2287
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 27 Region: 3434-3549
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 28 Region: 1980-2084
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 29 Region: 571-672
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000328
Family Cadherin 0.0025
Further Details:      
 
Domain Number 30 Region: 1361-1458
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000131
Family Cadherin 0.016
Further Details:      
 
Domain Number 31 Region: 2705-2814
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000136
Family Cadherin 0.0035
Further Details:      
 
Domain Number 32 Region: 375-452
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000971
Family Cadherin 0.0047
Further Details:      
 
Domain Number 33 Region: 3548-3637
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000457
Family Cadherin 0.004
Further Details:      
 
Domain Number 34 Region: 4098-4135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 35 Region: 4023-4061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 36 Region: 4060-4103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000023
Family EGF-type module 0.016
Further Details:      
 
Domain Number 37 Region: 42-158
Classification Level Classification E-value
Superfamily Cadherin-like 0.000006
Family Cadherin 0.01
Further Details:      
 
Domain Number 38 Region: 272-374
Classification Level Classification E-value
Superfamily Cadherin-like 0.00006
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003852   Gene: ENSMODG00000003108   Transcript: ENSMODT00000003938
Sequence length 4557
Comment pep:novel chromosome:BROADO5:4:266862414:267611604:-1 gene:ENSMODG00000003108 transcript:ENSMODT00000003938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDITMGCCTGTGPPPSCLVLLLLKLLASVSQGLPGTGPLGFHFTHSIYNATVYENSAART
YVNSQSRMGITLSDLSWDIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNRE
IQDNYLLNVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQV
TATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEVLAVDRGMKL
YGNNGVSSTAKLYVHIERINEHAPTISVVTHIPFSLDKEPTYAVVNVDDLDEGANGEIES
ISIVAGDPLEQFLLVKEGKWINEYKIKERKSIDWEGFPYGYNLTLQAKDKGSPQKFSAVK
VVHIANPQRDSIPIRFEKETYNVTISEFSPPGVVVAIVKLNPEPPGVEYRISPGEDAEYF
KINPRSGLIVTAQPLDVIKKEVYELAVSNKEGDLKAQVTIGLEDANDHTPEFQQSSYEAF
VNESVPMGTSVLSVSASDKDKGENGYITYSIASLNALPFSINQFTGVIRTTEELDFESSP
ENYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAV
SAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLINSGVKNGNFGLRITATDGEN
FADAMFVNISVLQGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSVNR
QGPHFDKSFPSDIAVKEDLPVGANILKIKAFDADSGFNGKVVFTISDGNTDSCFNIDMET
GQLKVLMPMDREQTDLYLLNITIYDLGKPQKSSWRLLTINVEDANDNRPIFLQESYSVNI
LESSSIGTEIIQVEARDKDLGPNGEVMYSVLTDAQQFSINSSTGIVYVADQLDRESKANY
SLKIEARDKSESGQQQFSVVTLKVFLDDVNDCSPTFIPTSYSVKVLEDLPVGTVIAWLET
HDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVS
LSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQY
SIRDGSGLGRFNIDDESGVIYTADILDRETTGSYWLTVYATDRGVVPLYSTIEVYIEIED
VNDNAPLTSEPIYYPVVMENSPKDISVIQIQAEDPDSSSNEKLTYRITSGNPQNFFVINI
KTGLITTTSRKLDREQQAEHFLEVTVTDGGSSPKQSTVWVVVQVLDENDNKPQFPEKVYQ
IKLPERDRKKRGEPIYRAFAFDKDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFT
AGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPVPLTFDEPFYNFTVMESDRVTEI
VGVVSVQPANIPLWFDVVGGNFDSSFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTN
VAVTQVFIKVLDNNDNGPEFSQPSYEVTISEDVLPDTEILQVEATDRDEKHKLSYTIHSS
IDSVSMRKFRIDASTGVLYIAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDAN
DHSPYFTSPLYEASVFESAALGSAVLQVTALDKDRGENAELLYTIEAGNTGNTFKIEPIL
GIITVSKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFTQKEYQAEV
NENVDIGTSVILISAISQSTLIYEVKDGNIEGIFTINPYSGVITNQKALDYERISSYQLI
IQATNMAGMASNATVNIQIVDENDNPPIFLFSQYSGSLSEVAPINSIVRSLGNNPLVIRA
TDADSNQNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGNPQ
LTAESPAEVNIEVTDVNDNPPVFTQAVFETVLLLPTYVGVEILKVQATDPDSDVPAELTY
SLMEGNLDYFLIDSNSGVLSIKNSSLSKDHYMLIVRVSDGKFYGTAMVTIMVKEAMDSGL
HFTQSFYFASISENSTNITKVAIVNAIGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGI
PFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPG
TLIYRVTALDRDKGANGEVTYTLQEDYGHFEINPESGSVFLKEAFNSDLSNIEYGVIILA
KDGGKPALSASVELPITIVNKAMPVFDKPFYTTSVNEDIEMHTPILSINATSPEGQGIIY
IIVDGDPYNQFNIDFDTGVLNVISPLDYEVTPVFKLTVRASDALTGARAEVTVDLLVNDV
NDNPPIFDQPTYNATLSEASLIGTPVLQVVASDADSENNKIVQYQIVQDTYNSTDYFHID
STSGLILTARMLDHESVQQSTLKVRATDNGFPPMSSEVLVNIYVTDMNDNPPVFNQLIYE
SYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGIITLSNHRKQR
MEPLYSLNVSVSDGLFTSTAQVHIRILGANLYSPAFSQSTYVAEVRENAAPGTKVIHVRA
TDGDPGMYGQIRYAIINDFAKDRFLIDNNGQVITTERLDRESPMEGDISIFLRALDGGGR
TTFCTVRVIVVDENDNAPQFLTVEYRASVRADVGRGHLVTQVQAIDPDDGVNSRITYSLY
SEASVSVADLLEIDPDNGWMVTKSNFHQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLP
PEILFPSFTQPQYSFAIPEDTVIGSTVDSLRILPNQNVVFSTVNGERAENNKGGVFIIEQ
DTGTIKLDKRLDREMTPAFHFKVAATIPLDKVDIVFTVDIEIKVLDLNDNKPFFDASSYE
AIIMEGMPVGTRLIQVKAIDKDWGANGQVTYALHSDSNAEKVMEVFSIDTNTGWISTLKD
LDHERDPTFTFSVLASDLGEAFSLSSTTLVSVTVTDINDNAPVFGHEVYREYVKESDPPG
EVVAVLSTWDEDTSDINRQVSYHITGGNPRGRFALGLVQNEWKVYVKRPLDREEQDIYFL
NITATDGLFVTQAMVEVTVTDVNDNSPVCDQVAYTALFPEDIPSNKIILKISAKDADIGP
NGDIRYSLYGSGNNKFFLDPESGELKTLALLDREKIPVYNLIARATDGGGRFCQSDIRLI
LEDVNDNPPIFSSDHYNTCIYENTATKALLTRVQATDPDLGINRKVVYSLADSAGGYFSV
DSSSGIIILEQPLDRELQSSYNISVKASDQSILKALSSLATVTITVLDINDNPPVFERRD
YLVTVPEDTTPGTEVLAVFATSKDIGTNAEITYLIRSGNERGKFKINLKTGGISVIEALD
YEMCKDFYLVVEAKDGGTPALSAVATVNINLTDVNDNAPKFNQEVYSAVISEDASIGDSV
IVLIAEDVDSPPNGQIRFSIVSGDRDNEFAVDPVLGLVKVKKKLDRERVSGYSLLIQATD
SGVPAMSSTVTVNIDISDVNDNGPVFTPANYTAVIQENKPVGTSILQLMVTDRDSFHNGP
PFTFTILAGNEEEEFVLDPHGILRSAVVFRHTDSPDYVLYIQAKDSGKPQQVSHSYIRVR
VIEESIHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDVYDVLTYSLKSEQRSLFKVNT
HDGKIIALGGLDSGKYILNVSVSDGRFQVPIDVIVHVEQLVQEMLQNTVTIRFENVSPED
FVGLHMHGFRRTLRNAVLSQKQDSLHIISIQPVAGTNQLDMLFAVQMNSGGFYKPAYLIQ
KLSNARRHLENVIRISAILEKNCSGLDCQEQHCEQSLSIDSHSLMTYSTARISFVCPRFY
RNVRCTCNGGLCPGSNDPCVEKPCPGDMQCVGYEASRRPFICQCPPGKLGECSGHTSLSF
AGNSYIKYRLSENSKKEEFKLALRLRTLQSNGIIMYTRANPCIILKIVDSKLWFQLDCGT
GPGILGISGRAVNDGNWHSVFLELNQNFTSLSLDDSYVERRKAPLYFQTPDTESAIYFGA
LVQVDNIRSLTDKRVTQVLSGFQGCLDSVVLNNNELPLQNKRSSFAEVVGLTELKLGCVL
YPDACERNPCQNGGSCASLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGN
TFICNCKVGLTGVTCEEDINECDREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVV
PNIQAGHSYVGKEELIGIAVVLFVIFVLIVLFIIFRKKVFRKNYSRNNITLVQDPATAAL
LNKSNGIQFKNLRGGGDSRNIYQEVGPPQVPVRPMAYTPCFQSDSRNNLDKIVDGLGVEH
QEMTTFHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKSVWDAGTENKGVDDTE
EVTCFVGSNKGSNSEVQSLSSFQSDSGDDNAYHWDTSDWMPGARLSDIEEVPNYESTDGT
SVHQGSTRELETDYYLGGYDIDSEYPPPHEEEFLSQDQLPPPLPEDYPDHFEALPPSQPA
SLASTLSPDCRRRPQFHPSQYLPPHPFPNETDMVGPPPGHEFSTFAVGVGQNVENTGVAD
STSLSLHNSIGASSSDVSASCGFDESEVAMSDYESVEELSLTSLHIPFIETQHQTQV
Download sequence
Identical sequences F6WDK1
ENSMODP00000003852 ENSMODP00000003852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]