SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003905 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003905
Domain Number 1 Region: 183-510
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.85e-77
Family Pancreatic carboxypeptidases 0.00000132
Further Details:      
 
Domain Number 2 Region: 45-166
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.22e-31
Family Frizzled cysteine-rich domain 0.00055
Further Details:      
 
Domain Number 3 Region: 510-588
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.39e-18
Family Carboxypeptidase regulatory domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003905   Gene: ENSMODG00000003209   Transcript: ENSMODT00000003991
Sequence length 659
Comment pep:novel chromosome:BROADO5:5:227858893:227927509:1 gene:ENSMODG00000003209 transcript:ENSMODT00000003991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPPFPLLLGLLGSLTGLTAAGPSCKPDQDTIGECHSSSTAENAKCANLELLYCNDVSYN
KTSYPNLLDQKSREVVEFSSEYILLSVIHNLLQGECNPDLRFLGCSILAPRCEGGRVMRP
CRHVCESLRKSCQPAFDGIDMAWPYFLDCDRFFVSQEEGCYNPLEKLRGGIDDTDGLSSN
ISSTFIQFTHHSYPQMVRVLKKTASRCSHIARTYSIGRSFDGKDLLVIEFSDRPGHHELL
EPEFKYIGNIHGNEVTGKEMLIYLAQYLCSEYLLGNPRVQHLINNTRIHLLPSMNPDGYD
VAAAEFHGAGYNGWTNGRQNSQHLDLNRDFPDLTSEYYRLASTRGVRTDHIPISQYYWWG
KVAPETKAIMKWMKAIPFVLSASLHGGDLVVSYPFDFSKHPLEEKMFSPTPDEKMFRLLS
RAYANVHPMMMDASENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGC
VKFPPEEALYTLWQHNKESLLNFMEMVHRGIKGTVTDKFGKPIKNARILVRGIRHDITTA
ADGDYWRLLPPGTHIVIAQAPGYTKMIKKVTIPLRMKRAGRVDFILHPLDLHPKKFMKGP
RRNGYKRHDPLEDFDPHAENNGDFLDERKRPLQDGNKPWWWSYFTSLNHHKPTWLLKYQ
Download sequence
Identical sequences F6TZK5
XP_007496867.1.35504 ENSMODP00000003905 ENSMODP00000003905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]