SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003927 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003927
Domain Number 1 Region: 41-503
Classification Level Classification E-value
Superfamily Cytochrome P450 1.13e-119
Family Cytochrome P450 0.0000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003927   Gene: ENSMODG00000003225   Transcript: ENSMODT00000004013
Sequence length 507
Comment pep:novel chromosome:BROADO5:2:31876534:31916254:1 gene:ENSMODG00000003225 transcript:ENSMODT00000004013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPLGNVLPSLQTLLLFSAILLILASYVQRRRRRQQSKYPPGPLRLPIFGNVFEIDIKK
PHISIQECVRKYGNIFSMDLLSAPMIVVTGLPLIKEVLVNQGQVFVDRPRSPLQSYIFKI
NGLFMSNGQEWKDQRRFTLMTLRNFGLGKKTLELRIQEEAIYLTEAIREEKGKPFNPHFQ
INNAVSNIICSVTFGNRFEYHDSQFRELLKSLNQQNLLESQCGFRPDHSTIDMVFTVRKM
QEKCLEQNLSLYIVFIDLTKAFDTVNRDSLWMILSKLRCPAKFIKLIQLFHGNISSSFNE
NNLVACTLDLFFAGTETTSTTLRWALLYMAFYPEIQGKIQAEIDRVIGHSRWPTMADREN
MPYTYAAIHEVQRMGNIVPLNAPRVATVDTTLAGYHVPKGTMLLTNLTALHRDPKEWATP
DTFNPEHFLEDGQFKKKEAFLPFSAGKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQ
LSLDFQAGMTLSPVFYQICALPRETEP
Download sequence
Identical sequences F7D563
ENSMODP00000003927 13616.ENSMODP00000037161 ENSMODP00000037161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]