SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003949 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003949
Domain Number 1 Region: 304-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-44
Family SPRY domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 8-74
Classification Level Classification E-value
Superfamily RING/U-box 7.73e-17
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 3 Region: 94-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000127
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003949   Gene: ENSMODG00000003243   Transcript: ENSMODT00000004035
Sequence length 469
Comment pep:novel chromosome:BROADO5:5:100558200:100563842:1 gene:ENSMODG00000003243 transcript:ENSMODT00000004035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKELIESLKAELTCSICLGYFTNPVTALKCGHNFCKDCLFQCDEQADATLTCPECRAV
IRYSDIVLNENLQDLSISGKALRQKLLFSLPLLTTCDQHGEKEKLFCEQDQKLICDSCLL
TQEHEDHQDIPLQMAADKCKVRLYQSLESNGFCFIKTFFDLQKELEETWIMLKGKEREFK
EAINKLKSSQEYFKKNTTYHRNLLRSEFLKMHEFLWIEENKHMQKLDQEVQDKLEKAKEN
EASLFQQLQHLQQKLLEIEESLDKAPLQMLQVMCHVFFRNEELQLQEPEVIFLTYRMYQM
IGLTEILRSYQRNITLGPETDSFHLIVPEEFKCLMYGDDSQDQPDNQERLDYFVTVLGAQ
TFDSGTHYWEVNVEDQTEWVFGICEESVNKNENVSIYSRYVRAIIGLKINDGILYWGTSN
SFYKNPTPKIGILLNYEEGDISFYDIKDKCVLFSFPNSIFRGPVRPFFS
Download sequence
Identical sequences F6THS5
ENSMODP00000003949 13616.ENSMODP00000003949 ENSMODP00000003949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]