SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003965 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003965
Domain Number 1 Region: 1910-2310
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.46e-119
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000000891
Further Details:      
 
Domain Number 2 Region: 1577-1906
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.49e-80
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000143
Further Details:      
 
Domain Number 3 Region: 241-492
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.36e-66
Family BC ATP-binding domain-like 0.0000000499
Further Details:      
 
Domain Number 4 Region: 92-240
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.03e-52
Family BC N-terminal domain-like 0.00000256
Further Details:      
 
Domain Number 5 Region: 502-616
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 8.89e-30
Family BC C-terminal domain-like 0.00000402
Further Details:      
 
Domain Number 6 Region: 745-818
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0000000012
Family Biotinyl/lipoyl-carrier proteins and domains 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003965
Domain Number - Region: 851-890,974-1153
Classification Level Classification E-value
Superfamily ARM repeat 0.00849
Family BC3264-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003965   Gene: ENSMODG00000003240   Transcript: ENSMODT00000004051
Sequence length 2348
Comment pep:novel chromosome:BROADO5:2:185946931:186222836:-1 gene:ENSMODG00000003240 transcript:ENSMODT00000004051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPSPLAKPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVSSDTLS
DLGLPSLQDGLALHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLQVDWRENDFSKRILNVPQDLYEKGYVKDVDAGLQA
AEEVGYPVMIKASEGGGGKGIRKVNHADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPVVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDVPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQQNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGAKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYA
EIEVMKMVMTLVSVESGCIHYVKRPGAALDPGCVLAKLQLDNPSKVQQAELHMGSLPRIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLALEYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMAHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSP
PQSPTFPEAGHTSLYDEDKAARDEPIHILNVAIKTDCDIEDDRLAAMFRDFTQQNKAALV
EHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
YGDKQGPLHGMLINTPYVTKDLLQSKRFQAQTLGTTYIYDIPEMFRQSLIKLWELMSAQA
FLPTPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEANIGMVAWKMTLKSPEYPEGRDII
VIGNDITYRIGSFGPQEDVLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAW
VDPDDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLR
GSGMIAGESSLAYDEIITISLVSCRAIGIGAYLVRLGQRTIQVENSHLILTGAAALNKVL
GREVYTSNNQLGGIQIMHHNGVTHSTVCDDFEGVLTVLHWVAYMPKNVHSPVPLLNSKDP
IDRIIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARL
GGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGL
PLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDP
TINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIRLAERLGTPELSP
AERKELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWR
LRRLLLEDLVKKKIHTANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQL
TEEDGFRSVVDENIKYISRDYILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRIL
STMDSPST
Download sequence
Identical sequences F6T1L2
ENSMODP00000003965 ENSMODP00000003965 13616.ENSMODP00000003965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]