SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003987 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000003987
Domain Number - Region: 304-402
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0169
Family Crotonase-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003987   Gene: ENSMODG00000003265   Transcript: ENSMODT00000004073
Sequence length 822
Comment pep:novel chromosome:BROADO5:4:375093673:375111781:1 gene:ENSMODG00000003265 transcript:ENSMODT00000004073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKQELGRGKWCGWGRCPPRTLLPTDFVLVWEEKLWLPGRGALAGLTKTERQRRQQQRWR
GKFQRNLQAAGLLLEEEETPGEQRAVHYLKLSAPWEVLIYYAEDLCMRAPLQVQPNPDAD
GSAEILRRLRLPNLLQQHVPNKPLGFYTCAFRRSKLSKFLGSDAPESYFSNTQRHRVVAE
ILARTAYGKRKHAEMGIARLLAEGVYTAAFPLHEGPFELPGYPVPGADLNPRQLLYSYWA
RWRCWHKYQPLDHVREYFGEKVAIYFAWLGFYTAWLLPAAIVGTLVFLSGLLTIGTNTPA
KEICASGGTFVMCPLCATCATWNISEICPMAKLGYLFDNPGTVFFSIFMSFWAMAFLEHW
RRKNATLAHHWDCADFQEEEERPRPEFAAMAPQMAQNPVTGLKEPYFPPRARLSRMVTGS
MAILVMLCVVMIFLVSVIMYRGIVSIVMFHTGNPVLMTQAGNIANISSTFLNLVLILLMG
KVYTSLAEQLTKWEMHRTQTLHEDAFTFKVFIFQFVNFYSSPFYVAFFKGRFVGYPGQYG
TLLGMRNEDCGPGGCLIELAQQLFIIMVGKQLANNVEEFVLPKIKAWWQKRQLAGLWGTQ
MGHDPRRWEDDYELIECEGLFEEYLEMVLQFGFITIFVAAFPLAPLFALLNNWVEIRLDA
HKFVCEYRRPVAERAQGIGVWLLILETMAHLSVIVNAFLIAFTSDFLPRLLYQYEHHSHL
QGYVNFTLAQAPHTYLAQGNHTPCRYKAFRDETGNFTLFYWKLLAVRLGFILAFEHVVFF
FLRLIAWLVPDVPAELALQVKRERYLAKQALADNQDALFSMK
Download sequence
Identical sequences F6SJY7
ENSMODP00000003987 ENSMODP00000003987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]