SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004007 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004007
Domain Number 1 Region: 38-107
Classification Level Classification E-value
Superfamily Cytochrome P450 0.00000000000000471
Family Cytochrome P450 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004007   Gene: ENSMODG00000027382   Transcript: ENSMODT00000004093
Sequence length 127
Comment pep:novel chromosome:BROADO5:2:31438650:31441602:1 gene:ENSMODG00000027382 transcript:ENSMODT00000004093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPLGTVLPSLWEGAPLQTLLLLSAILLILASYLQRKRRQANYPPGPSPLPLLGNFFQI
DFKKPQVAFQEFVRKYGNVFCMELGSFTFVFVTGMPLIKEVLVNQDQXXXXXXXXXXXXX
XXXXXXX
Download sequence
Identical sequences F7EGH8
ENSMODP00000004007 ENSMODP00000004007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]