SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004010 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004010
Domain Number 1 Region: 149-285
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-29
Family Cadherin 0.0000244
Further Details:      
 
Domain Number 2 Region: 374-507
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-26
Family Cadherin 0.00011
Further Details:      
 
Domain Number 3 Region: 267-379
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-23
Family Cadherin 0.0000153
Further Details:      
 
Domain Number 4 Region: 57-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000003
Family Cadherin 0.0000158
Further Details:      
 
Domain Number 5 Region: 488-591
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000785
Family Cadherin 0.0000473
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004010
Domain Number - Region: 11-73
Classification Level Classification E-value
Superfamily Cadherin-like 0.000157
Family Cadherin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004010   Gene: ENSMODG00000003284   Transcript: ENSMODT00000004096
Sequence length 775
Comment pep:novel chromosome:BROADO5:1:698572510:698593616:1 gene:ENSMODG00000003284 transcript:ENSMODT00000004096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPGQVPELLSTDDHFTVVSDGTILVKHPLSLPDRRTFSIYSSSTRHSLRRRKREWVVPPI
SVSENGKGPFPQRLNQLKSNKDKATKIFYSITGPGADSPPEGVFTIEKETGWLLVNQPLD
REKMAKYELFGHAVSENGASVEEPMNISIVVIDQNDNKPQFTQEVFKGSVTEGAMPGTSV
MQVSATDADDPNTDNGAIAYFILDQNPKDPHDHMFTIHRETGAISVIASGLDRERVAEYT
LTIQVADMEGEGLSTTASAVVEIADANDNAPVFDPQKYTAEVLENKVGVEVQRLTVTDLD
APNTPAWRAVYQITQGDEGGYFAIATDPENNQGILTTKKGLDFETKNQFTLYIVVSNEAP
FVVKLPTSTATVTVNVADVNEAPAFLPPTKVVEVYEGVPMGEKICTYTAQDPDKQQNQKL
SYQIVSDPAEWLMIHPESGDITARGLLDRENEQFVSNNTYKVTVLAIDDGNPPATGTGTL
LLTLVDVNDHGPIPEPLQITICNQKTVPQVLNITDKDLPPHTSPFRAQLTHDSDIYWNAE
MNERGDSVALSLKKFLKSDDYKIYLSLYDNHNKDQLTVIKAKVCDCEGHVSICPGAWKGG
FVLPVLGAVLALLILLLALLLLVRRKRKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYD
ITQLHRGLDARPEVILRNDVVPTFIPPPLYRPRPANPDEIGNFIIENLKAANSDPTAPPY
DSLLVFDYEGSGSDAASLSSLTSSNSDQNQDYDYLNEWGSRFKKLADMYGGGEDD
Download sequence
Identical sequences F7EGB5
ENSMODP00000004010 ENSMODP00000004010 13616.ENSMODP00000004010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]