SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004020 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004020
Domain Number 1 Region: 39-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-38
Family Laminin G-like module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004020
Domain Number - Region: 1596-1646
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00837
Family Fibrinogen C-terminal domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004020   Gene: ENSMODG00000003278   Transcript: ENSMODT00000004106
Sequence length 1807
Comment pep:novel chromosome:BROADO5:2:470298605:470599630:-1 gene:ENSMODG00000003278 transcript:ENSMODT00000004106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERWSTRWKTKRWLWDSTITTFVVITLIFQAAEVRGATPVDVLKALEFHNSPEGISKTAG
FCTNRRNSKGSDTAYKVTKQAQISAPTKQLYPGGTFPQDFSILFTVKPKKGIQSFLFSIY
NEQGIQQIGVEVGRSPVFLYEDQHGKPAPEDYPLFRTVNIADGKWHRIAISVEKKTVTMI
VDCKKKTTKPLQRSDKAVVDTNGITVFGTRILDEEVFEGDIQQLLITADPKAAYDYCEHY
SPDCDSPTPNAAQAQEPHIEEYAPEDIIEYDYEYGEAEYKEAESITEAPPLIEETIAQTE
ANVVDDFQEYNYGTSESYQTENPRRVSGPNEQDPVEEVFTEEYITGEDYESQRKTVEDNQ
YENKGVDGRDSDLLVDGDLGEYDFYEYKEYEDKPTNPTNEEFGPGVPAETDITETSIHGH
GAYGEKGQKGEPAVVEPGMLIEGPPGPAGPAGLMGPPGLQGPTGPPGDPGERGPAGRPGL
PGADGLPGPPGTMLMLPFRYGGDSSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGR
PGPVGGPGSSGAKGEGGEPGPQGPRGVQGPPGPTGKAGKRGRPGADGGRGMPGEPGAKGD
RGFDGLPGLPGDKGHRGERGPQGPPGSPGEDGMRGEDGEIGPRGLPGEAGPRGLLGPRGT
PGPTGQPGIAGVDGPPGPKGNMGPQGEPGPPGQQGIPGPQGLPGPQGPIGPPGEKGPQGK
PGLAGLAGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGE
KGEDGFPGFKGDMGLKGDRGEVGQLGPRGEDGPEGPKGRAGPTGDPGGPGQAGEKGKLGV
PGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGK
PGPKGTSGSDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGK
TGPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGVSGK
DGPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPLGSPGERGSAGTAGPIGLPGRPGP
QGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGS
KGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGL
QGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPSGSVGSVGGVGEKGEPGE
AGNPGPPGESGPGGPKGERGEKGEAGPPGAAGPPGIKGPPGDDGPKGNPGPVGFPGDPGP
PGEPGPAGQDGVGGDKGEDGDAGQPGPPGPSGEAGPPGPPGKRGPPGAAGSEGRQGEKGA
KGEAGSEGAPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPLGPPGL
PGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGTPGAKGDGGIPGPAGPVGP
PGPPGLPGPQGPKGNKGSSGPTGQKGDSGLPGPPGPPGPPGEVIQPLPILSPKKTRRHAE
GMQADAGDNILDYSDGMEEIFGSLNSLKQDIERMKYPMGTQNNPSRTCKDLQLSHPDFPD
GEYWIDPNQGCSGDSFKVYCNFTAGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGK
LLSYLDVEGNSINMVQMTFLRLLSASARQNFTYNCHQSVAWYDVTSNSHDKALRFLGSND
EEMSYDNNPYMKALYDGCASRKGFGKSVIEINTPKIDQVPVVDVMINDFGDQNQKFGFEV
GPVCFLG
Download sequence
Identical sequences F7EG27
ENSMODP00000004020 ENSMODP00000004020 XP_001372234.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]