SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004061 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004061
Domain Number 1 Region: 336-725
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.11e-81
Family Ankyrin repeat 0.00000358
Further Details:      
 
Domain Number 2 Region: 12-98
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000118
Family Caspase recruitment domain, CARD 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004061   Gene: ENSMODG00000003323   Transcript: ENSMODT00000004147
Sequence length 750
Comment pep:novel chromosome:BROADO5:2:33358941:33361193:1 gene:ENSMODG00000003323 transcript:ENSMODT00000004147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSSTPGRNSPYATQVMKMKKEELAAGIKDADLLLKRLVDYGIFTSEQKLALSHYETHLE
KVNRILDILISQGEHACQVFFYPCLKQLEPNLYQIIRKYTMGTDEIMYRTRQQSVGHFLD
GNKNGLEKSAEKIQKKHNTMIQAASVKPKLVSYLAAKTKGYPASQTPRNSPTSPIHALNA
SGKGDVDVENGLENRHGCKVMSPRENPLGAAVAKSLDEIHNYSMIKSFKAEGKDGKEKSL
LQRAAERARGDAEKVLQGGMSGNNLDSRVPMGFHVQGGKHTVMRLMLERNPGNPYYLQYR
PALQAEDQGVQVCLEDDNLLNAMDKADTASTFPGTNSLEEAIKILLTTGINADSGILHNA
FHHDDQVVIQLLLKHSSILPSETKEQALFEGIRKNLPRVVTALVDVGTNLNARDHNQYTP
LLLAAEMDRAACANVLIRRGANMAARTAHLDSALHLAVKAGAVYTVELLLDNGMSPNLAG
WNGQTSLHTAAWYNKHEMVNILINAGANINALTTEQNTPLHITSERGHVDTAIQLIQQAA
DLNMKNKLSMTPLHLAARAGNMTMVELLLHSGADPNVPDREKKTALHWAASASFIKVVKY
LLNYKARSGTRDMDGYSPLHYAALKGNVELVKIFLEAGKNKNINERNIYRKTPLHLAVEQ
GHTELIKMLINNGAAVNALDNNRDTPLHCACKTGHWGSVTSLINCSQREKPDLQASNSLG
KTPLQVAEGSATQSQEQIVTLLRKKMFLTR
Download sequence
Identical sequences F7DXZ4
13616.ENSMODP00000004061 XP_007480566.1.35504 XP_016285368.1.35504 ENSMODP00000004061 ENSMODP00000004061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]