SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004078 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004078
Domain Number 1 Region: 275-441
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-42
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily RING/U-box 1.68e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 88-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000885
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004078   Gene: ENSMODG00000003333   Transcript: ENSMODT00000004164
Sequence length 444
Comment pep:novel chromosome:BROADO5:5:100145802:100150809:-1 gene:ENSMODG00000003333 transcript:ENSMODT00000004164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIESFKAELTCSICLGYFTDPVTAFKCGHTFCKDCLLQCDEQADATLTCPECRAVIRYSD
IVPNENLQNLSITGKTLRQHLLLSPALLTTCDQHGEKEKLFCEQDQKPICDSCLLTQEHK
DHQDLPLQMAADKCKKKLLETRNVLQKKEEEVKNSINKLREKKTYFREDIDYQMLLVRNE
YSKMHEFLWNEEKDFIQEMDQERDENLAKIEEKEASLSQQIQQLQQRILEIEESLDEEPL
EMLQCFMLFRNEELLLQETETINLTYSTYPMTGLIEILRSYQKDITLDLETDSFHITVPE
VFKSLKYGHDSQDQADNQERFDYFITALGAETFVSGTHYWEVDVEGHTEWVLGICEDSDS
KNENVSIFSHDITAIIGLKVENQLLLWSPSIFFCKIPVYKIGILLDYEEGHVTFYDITGS
RPLFSFQKSAFEGSVRPFFSTSLF
Download sequence
Identical sequences F7DCX9
13616.ENSMODP00000004078 ENSMODP00000004078 ENSMODP00000004078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]