SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004082 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004082
Domain Number 1 Region: 319-478
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-40
Family SPRY domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily RING/U-box 2.01e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 93-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000412
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004082
Domain Number - Region: 149-236
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0353
Family Fibrinogen coiled-coil and central regions 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004082   Gene: ENSMODG00000003338   Transcript: ENSMODT00000004168
Sequence length 482
Comment pep:novel chromosome:BROADO5:5:100114340:100120117:-1 gene:ENSMODG00000003338 transcript:ENSMODT00000004168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKDLIKSLKAELTCSICLGYFTDPVTALKCGHTFCKDCLLQCDEQADATLTCPECRAV
IRYSDIVPNENLQNLSITGKTLRQHLLLSPTLLTTCDQHGEKEKLFCEQGQKPICDSCLL
TQEHKDHQDLPLQMAADKCKKKLQETGNVLQKKEEEFKKAINKLRKKKAYFKRHTNYYKE
LIKFEYRGMHEFLWKEENKQMQAMDQEINENLAKFEEKEASLSQQIQQLQQRILEIEESL
DAEPLEMLQVKMGKESEERGSLTLSKPFPLPPQVWEELRPLQHEHLKESQLFIIKEFGRG
VAFNLQDLASMVNNSISFSIADITLDPETDSFHLIVPEEFKRLKLRHGSQDQPYKPERLD
YFVTMLGAQTFTSGTHYWEVDVESHKEWVLGICDDSVRKNENVSIFSRYITAIIGLKVDN
EILIWSPSTFFCNIPIQKIGILLDYEDGHVTFYDINNSRPLFGSRNSAFQGPARPFFSNS
LS
Download sequence
Identical sequences F7DCI2
13616.ENSMODP00000004082 ENSMODP00000004082 ENSMODP00000004082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]