SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004094 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004094
Domain Number 1 Region: 103-169
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.88e-16
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 296-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000126
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 204-261
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000513
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004094   Gene: ENSMODG00000003346   Transcript: ENSMODT00000004180
Sequence length 406
Comment pep:novel chromosome:BROADO5:6:33176089:33315236:-1 gene:ENSMODG00000003346 transcript:ENSMODT00000004180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGAASAAGTTLRLPAAPPLAFCYTSVFLLFAFSVPGSRASNQLPGGGGGGGGAGAGA
GAAAGGGGGAAGGGGGGDCPGTGKGKSINCSELNVRESDVRVCDESTCKYGGLCKEDGDG
LKCACQFQCHTNYIPVCGSNGDTYQNECFLRRASCKHQKEITVVSRGPCYSDNGSGSGEG
EEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPC
FVREASCVKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQREDIYIGNHIP
CPENFNGYCIHGKCEFVYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAA
IIGAVQIAIIVAIVMCITRKCPKNNRGRRQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences F7CTI6
XP_007498118.1.35504 ENSMODP00000004094 ENSMODP00000004094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]