SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004112 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004112
Domain Number 1 Region: 20-185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-31
Family Trypanosoma sialidase, C-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004112   Gene: ENSMODG00000003360   Transcript: ENSMODT00000004198
Sequence length 338
Comment pep:novel chromosome:BROADO5:2:538855836:538860596:-1 gene:ENSMODG00000003360 transcript:ENSMODT00000004198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRMIQARGARGFQLSAVANTRLLSFPASRIFLHCDLFPEEFSIVVTLKVLSLPAKKNEYI
FAVVEDHSDTLLLGLRYSPDKLHFVFLSREPSGSWQTRVTFQDVPLTDDRWHTLVLAVSE
GSFSLTADCSVPTDVMVDTPFPVSLSMEGSRFFIGSRRREKGIFTGLLRQLVLLPGSDAT
SQICPSRNAQLAVLSIPSVLQDLTGSPADRVLHYPYEADLKVSLGPRPQCTQMEDARFWL
DVSRRGLYLCVANEWIAMIEAKVKLDYVEEHQRLATLSETLGIEVFTIPHVGLLAAAANR
QATSTVYKWVDGKFVSYQNLPTQQAQAWKHFTIGKKVR
Download sequence
Identical sequences F6ZPS9
ENSMODP00000004112 13616.ENSMODP00000004112 ENSMODP00000004112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]