SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004117 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004117
Domain Number 1 Region: 62-362
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.83e-47
Family beta-glycanases 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004117   Gene: ENSMODG00000003366   Transcript: ENSMODT00000004203
Sequence length 690
Comment pep:novel chromosome:BROADO5:1:228567409:228824587:1 gene:ENSMODG00000003366 transcript:ENSMODT00000004203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLKVWTNRLRGLLLQWLLLLSLLSATGSFRSKIFTKHVLRSNLSTSFYVLDDTPGLDR
VFDGIGGVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTE
PSHMHYKGDENYFRGYEWWLMKEAKKRNPNIKLIGLPWSFPGWIGSGKSWPYDSPSITAL
YIVSWILGAKKYHNLDIDYIGIWNERSFDIQYIKILRKMLNQKDLDRVKIIASDNLWLPI
SISMLLDDELLDAVDVIGAHYPGTHTVQDALKTNKSLWSSEDYSTFNNEVGGGCWARILN
QNFVNGHMTSTIAWNLVASYYPQLPFGRDGLMTAQEPWSSHYVVETPIWISAHTTQFAQP
GWRYLKTVGHLQNGGSYVALTDGLGNLTIIIETMTHEHSKCIRPPLPFFLVSEQTTTFSL
QGTFKELRMLQVWYSKLGKKPWNDTFLFKQLPPLKITNGTVTLQLGLDEVYTLTTITTGQ
KGSHPTPPESRPFPSNFEDNFNVGNPPFSEAPNFADQTGVFEYFTNDQDTSGHSFTLRQV
LTQRPITWAMDADQTISIIGDHNWRDITITCDVYMETPVTGGIFIAGRVNKGGSFIRSAQ
GVFFWILANGTYEVTGDLERRRIIKGGKANVMAKKWYTLTLNITDSSAYGMLNNRVLWKA
QLKHLPRNGWAAIGTHSFEFGQFDNFHIQA
Download sequence
Identical sequences F6ZPN8
ENSMODP00000004117 ENSMODP00000004117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]