SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004158 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004158
Domain Number 1 Region: 784-852
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000512
Family IBR domain 0.0000208
Further Details:      
 
Domain Number 2 Region: 75-169
Classification Level Classification E-value
Superfamily PUG domain-like 0.00000000000405
Family PUG domain 0.0045
Further Details:      
 
Domain Number 3 Region: 701-766
Classification Level Classification E-value
Superfamily RING/U-box 0.000000053
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 4 Region: 357-384
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000785
Family Ran binding protein zinc finger-like 0.0023
Further Details:      
 
Domain Number 5 Region: 864-935
Classification Level Classification E-value
Superfamily RING/U-box 0.00000789
Family RING finger domain, C3HC4 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004158
Domain Number - Region: 409-431
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00102
Family Ran binding protein zinc finger-like 0.0045
Further Details:      
 
Domain Number - Region: 311-336
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0011
Family Ran binding protein zinc finger-like 0.0033
Further Details:      
 
Domain Number - Region: 581-619
Classification Level Classification E-value
Superfamily UBA-like 0.00601
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004158   Gene: ENSMODG00000003397   Transcript: ENSMODT00000004245
Sequence length 1075
Comment pep:novel chromosome:BROADO5:1:173493076:173500716:1 gene:ENSMODG00000003397 transcript:ENSMODT00000004245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEGLQEEERVFLAAREELVSALRKDPGQSFSPEQLHRLLDNPLPLATRYPKLNASQLV
QSNAQGGEPRDYLQNLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGR
EVLRLYGYTEEQPDGLSFPEGQEEPDGHRVATVTMDVLLLRTELTLLLENSHPRSEALEQ
LLKEGSNGEMLPFSESVSPLRETTSNSLPAPQTQGTTSGSCFLCGSVPGTLHCPTCGHAL
CPACDCLFHRHPSRAHHLRQPVPGNHPASNLSSSLSNLALPRPLLTSPPTFGDSSLPSWS
SPTPEPPSTRPPWHCAACAMLNEARAVLCVACDRPRGCKGVGQGIENPRAGIGGGPHRGR
WSCQSCTFENEPATVLCAICERPRLAQPPSLVGDVRDTGACLPALEAGDWHCVHCTFRNS
GPGWVCTMCNRTSSPTPPLLPSWIPNSLGEGARTSVCLKPVSAHQISTPSASLHALRGDL
EQQRQDKMREDGLRLVAMIRAGEAEGACPEEVFSALQYSGTEVPLQWLRSELPYVLEMVA
EMAGRQDPSLGAFSCQEAKQAWLIRHGNLDEAVEECVRARRRKVRELEILGFGPEEGTLQ
ALYQHGGDVGRALTELQRHRLEPFHQRLWEAPEPNPSWDGPDKQSLIRRLLAIYALPSWG
RAELALSLLQETPRNYELMDVVEAVRHSPDRAFLRRLLAQECAVCGWALPRNRMQALTSC
ECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDETQLVSYFSTLDIQLRESLNPDA
YALFHKKLTERVLMRDPKFLWCTQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHQ
GRSCEDFQSWKRANDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQF
CSGCYSAFYAKNKCPDPNCRVKKSLHGHHPRDCLFYLRDWDALRLQKLLQDNSITFNTEP
PAGTRAVPGGGCRVMEQKEVPGGLKDEACGKETPTGYAGLCQAHYKEYLVSLINAHSLDP
AMLYEVEELETATERYLHVRPQPAAGEEASAYQARLLQKLLEEVPLGQNITRRKK
Download sequence
Identical sequences F6Z0X2
13616.ENSMODP00000004158 ENSMODP00000004158 XP_007479924.1.35504 XP_007479925.1.35504 ENSMODP00000004158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]