SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004168 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000004168
Domain Number - Region: 58-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0704
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004168   Gene: ENSMODG00000003405   Transcript: ENSMODT00000004256
Sequence length 95
Comment pep:novel chromosome:BROADO5:6:221749901:221839897:1 gene:ENSMODG00000003405 transcript:ENSMODT00000004256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDGKTSIVIGKWWCEM
EPCLEGEECKTLPDNSGWMCATGNKIKTTRVSGFI
Download sequence
Identical sequences F6Z056
13616.ENSMODP00000004168 ENSMODP00000004168 ENSMODP00000004168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]