SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004183 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004183
Domain Number 1 Region: 561-606
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 119-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000016
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 66-113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004183
Domain Number - Region: 515-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0074
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004183   Gene: ENSMODG00000003418   Transcript: ENSMODT00000004271
Sequence length 606
Comment pep:novel chromosome:BROADO5:2:35326260:35425803:-1 gene:ENSMODG00000003418 transcript:ENSMODT00000004271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMLLTAFLRDRRTGAFAMGQWLLNGIVALAFLAFCPMSGQYLTSAQDKLRRRIERADQP
STPAPVDCQLSEWSAWTECIPCLGQKHRYRNLLQPSKFGGNLCLGDLWDEAACTSPEACT
AQIQCGYDFQCKESGRCIKRRFLCNGDQDCNDGSDEEDCEESGILKNDCLEFNPIPGSEM
AAQGYNILTEEEKMYVYDPVFFGGLCERVYNGDWKSLRYDPVCENLDYDEKYFRRPYNFI
KYQFETQAQSEFHSHFYSHVEELTTALHKEKFSSKSVSIGIPIYSVILGIGVSLASGKGS
LNNLTKYTEEEYGFIRAYTRAHTAQFRMRRDNIVLAEDMLQAITELPDQYDYGMYTKFIN
DYGTHYITSGAMGGIFEYILVINKEVMKTKKVTDEAVSSCFGASLGLQYKFVQGQVMGSK
CKKDGDGSYEKALKDMGVRDVISRVRGGTTAPSSGLSNSWTAETYLSWGRSLKDNPAVID
FELLPIFSVLRQSNLGPHEQKWQNMRRALDEYLAEHDTCRCGPCVNNGEPILEGNSCLCK
CPLGRSGPACEKMEHQGSSSDGRWSCWSSWSPCQVGIKERSRSCSNPAPQNGGAPCQGSS
TERLEC
Download sequence
Identical sequences F7GKN0
ENSMODP00000004183 ENSMODP00000004183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]