SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004243 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000004243
Domain Number - Region: 998-1102
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00034
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 587-805
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004243   Gene: ENSMODG00000003468   Transcript: ENSMODT00000004332
Sequence length 1105
Comment pep:novel chromosome:BROADO5:6:222380714:222409227:-1 gene:ENSMODG00000003468 transcript:ENSMODT00000004332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWFNASQLSSFAKQALSQAQKSIDRVLDIQEEEPGAWAEALPFGDPGNSSPVSGGWDTS
TWRLNSNTEPQSQPVATPKAITKPVRRTVVDESESFFSAFLSPTDVQPIQQSPVVSKPPT
KSQRPEEVTSSLQEPLQPGQSETPESTELEVTDSSLLASQEDLKNSPVSLENLEVETPTL
NNEVKPQEIRHDAVGIKVSALSMNVAESTTDVKTAESAPNGQAPIVEAKDLVLDAKEQKH
EDRQSNTPSPPVSTFSSGTSTTSDIEVLDHESVISESSASSRQETTDSKSALHLMQTSFQ
LLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSGKGYT
LVPITANSSTPKTKIAESVEGKSEEENETLVVPSEETEMEESGRSATPVNCEQPDVLVSS
LQPSEGYMVSEKVTGQCQDIENQPQLCPEKEDFCKTIDLLNEKLEKRETQLLTVSKEKAV
LEEAYDNLKDEMFRVKKESKSISSLKDEFTQRIAEAEKKVQLACKERDTAKKEVKTIKEE
LATRLNCNETTELLKEKDEQIKGLMEEGEKLSKQQLHNSTIIKKLRAKERENEHISAKQS
KKIKELEEELQHLKQVLDGKEEIEKSHRENIKKLNSVVERQEKDLGRLQIDMDDLGEKNR
SAQAALDSAYKELADLHKANAMKDTEVQEASLSREMKVKEELCLALEKAQEEAHQQQEAL
AIQVGDLRLALQRAEQAAARKEDYLRHEISELQQRLQEAENRNQELSQSVTSTTRPLLRQ
IENLQATLGAQTSSWEKLEKNLSDRLGETQASLAAAVERERAAVEELLNNKMQVSSMESQ
NTILRQENSRLQVQLEAEKNRLQKLEDENSRYQVELENLKEDYGKTLEEARKEKTLLNSQ
LEMEKMKVEQERKKAILSQEMMKEKERKTFSFSTLETVSSTPTLSRSSSISGIDMAGLQT
SYLSQDESQEHSFGPMSGSVNGSNLYDAVRMGAGSSIIENLQSQLKLKEGEITHLQVEIG
NLEKTRSIMAEELVKLTNQNDEFEEKVKEIPKLRAQLRDLDQRYNTILQMYGEKAEEAEE
LRLDLEDVKNMYKTQIDELLQQRLT
Download sequence
Identical sequences F7DC44
ENSMODP00000004243 ENSMODP00000004243 XP_001363891.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]