SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004449 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004449
Domain Number 1 Region: 261-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.05e-37
Family Laminin G-like module 0.0000000345
Further Details:      
 
Domain Number 2 Region: 463-672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1e-33
Family Laminin G-like module 0.00000043
Further Details:      
 
Domain Number 3 Region: 48-107
Classification Level Classification E-value
Superfamily GLA-domain 9.92e-21
Family GLA-domain 0.00055
Further Details:      
 
Domain Number 4 Region: 108-237
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000133
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004449
Domain Number - Region: 236-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004449   Gene: ENSMODG00000003633   Transcript: ENSMODT00000004545
Sequence length 677
Comment pep:novel chromosome:BROADO5:7:76611011:76705345:1 gene:ENSMODG00000003633 transcript:ENSMODT00000004545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPQQQPAPAAALSTVLLLLLLATDSSQTVLLRAREATQFLRPRQRRANQIFEETKQGH
LERECIEELCNKEEAREVFENDPETDYFYPRYLDCIAKYGSPYLKNINFISCVRDLPDQC
TPYPCEKKGTVNCQDLMGTFYCQCKTGWSGRTCDQDVNECNHQNGGCSQICYNQIGGFSC
ACYTGYKLLLNNKTCEDIDECTDASACGEARCKNLLGSYSCICEEGYVYNNEKKVCQDVN
ECEEKLCEQTCVNSPGSYACHCDGRGGVKLSHDMNTCEDILPCISFDVAKSVKSLYLGRM
SNGAPVIRLRFKRLKPTRVVAEFDFRTFDPEGVIFFAGGRQDNTWIMLALRAGRLELQLK
YNNIGRVTSSGPVINNGMWQTISVEEVERNLVIKVNSDAVMKIAVSGELFQLYRGLYQLN
LTVGGIPFKDKYLVHPINTRLDGCMRSWNWLDGDDTTIQDIVKMNSRMQCFSVMSRGSFY
PGNGFAYFSLNYTQPFVGDETQRTWGIEITVKIRPATDTGVLLALVSEEKTVPLSLALVD
YHSTKKLKKQLVVLAVEHIPMTFMEIKACDGQDHLVEVHIKEGEIALTVDGTKGQIEVSP
SQLEERLSALKNYLQRPLRTYTGGVPDVPVMSAPVTAFYHGCMTLTVNQKTLDLDEAMYK
HGDITSHSCPPNEQAGP
Download sequence
Identical sequences F7BMD1
ENSMODP00000004449 ENSMODP00000004449 XP_001373525.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]