SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004469 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004469
Domain Number 1 Region: 532-747
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-104
Family Thrombospondin C-terminal domain 0.0000000951
Further Details:      
 
Domain Number 2 Region: 405-530
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.15e-33
Family TSP type-3 repeat 0.00000275
Further Details:      
 
Domain Number 3 Region: 27-72
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 6.41e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00018
Further Details:      
 
Domain Number 4 Region: 337-409
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000706
Family TSP type-3 repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 262-348
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000353
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 6 Region: 172-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 89-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004469
Domain Number - Region: 226-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000174
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004469   Gene: ENSMODG00000003651   Transcript: ENSMODT00000004567
Sequence length 760
Comment pep:novel chromosome:BROADO5:3:452056133:452070342:-1 gene:ENSMODG00000003651 transcript:ENSMODT00000004567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPSLGLLLLAFACHLVTGQRQAPVGGDVAPQMLREMKETNLVLQEVRELLKQQIKEITF
LKNTVMECDACGMQPVTSPWTSVRPLNRCEPDSCFPGVTCTETPGGGFRCGPCPPGYSGN
GSHCTDVNECNAHPCYPRVRCINTSPGFRCEACPPGYSGPVHEGVGLAFAKANKQVCTDI
NECETGQHNCVPNSLCTNTRGSFQCGPCKPGFVGDQASGCRRRAQRMCPNGEPSPCHENA
DCILERDGSTSCVCAVGWAGNGLVCGKDTDLDGFPDEKLRCPDRKCRKDNCLKVPNSGQE
DVDKDGIGDACDPDADGDGVLNEQDNCVLVRNPDQRNSDGDKWGDACDNCRGEKNDDQRD
TDRDGRGDACDDDIDGDRIRNALDNCPRVPNPDQRDSDRDGVGDACDNCPQKGNADQRDV
DHDLVGDACDSDQDQDGDGHQDSRDNCPTVPNSSQQDTDKDGQGDACDDDDDNDGIPDHR
APGPDNCRLVPNPNQEDADGDGVGDACQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTV
VLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTLTDDDYA
GLIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHT
GDTTDQVKLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTM
RGGRLGVFCFSQENIIWANLRYRCNDTIPEDYEAYRLQQN
Download sequence
Identical sequences F7AZT2
ENSMODP00000004469 ENSMODP00000004469 13616.ENSMODP00000004469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]