SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004502 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000004502
Domain Number - Region: 341-452
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00012
Family Myosin rod fragments 0.0083
Further Details:      
 
Domain Number - Region: 167-401
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004502   Gene: ENSMODG00000003676   Transcript: ENSMODT00000004601
Sequence length 652
Comment pep:novel chromosome:BROADO5:2:466813003:466849660:-1 gene:ENSMODG00000003676 transcript:ENSMODT00000004601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVLFRQLVPLQVKYKDCEERRINVRVSIELQSVSNPVHRKDLVIQLTDDADPFFLYNL
MISEEDFQSLKLQQGLLVDFSAFPQKFIDLLQQCTQEQGKEIPRFLLQLVSTAAILDHSP
VFLNVVETNPFKHLTHLSLKLLPGNDMEIKKFLASCLKCSKEEKLSLEQTLEDVTRQFNF
TQQTLSEKIQELDKLRNEWTSHTAALTNKHSQELTNEREKALQAQVQSQQQHEQQKKDLE
SMHQRNIHQLQNRLSEMEVANKDLTERKYKGDSTIRELKAKLSGVEDECQRAKQEVLSLR
RENSTLDVECHEKEKYINQLQTKVAVLEQEIKDKDQLVIRTKEAFDTIQEQKVALEENGE
KNRIQLGKLETTIKSLSAELLKANEIIKKLQGDMKTLMSKLKLKNTVTIQQEKLLAEREE
KLKKEQKEVQDIGQALQSKEQEVSKLQEQLEATVQKLEESKQLLKNNEKLITWLNKELNE
NQLVRKQELLGPSTTSPAQLSNSTVRSGISPNPNMLDNRLPLPNCGIGYTVPSTFTYHST
FPHSIAMKNTVHPVSGPKVQFNLQFAKTNTSGDVPSGGSINIPRSTDKENGENLGLEAKY
LKKREDSIPLRGLSQNLFNNIEHQKDGPLTTLQASSKPGVLPPVASAYFPGQ
Download sequence
Identical sequences F7FAN2
ENSMODP00000004502 ENSMODP00000004502 XP_007485284.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]