SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004543 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004543
Domain Number 1 Region: 70-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.24e-84
Family Calnexin/calreticulin 0.00000000468
Further Details:      
 
Domain Number 2 Region: 279-419
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.68e-59
Family P-domain of calnexin/calreticulin 0.0000000457
Further Details:      
 
Domain Number 3 Region: 421-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000918
Family Calnexin/calreticulin 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004543   Gene: ENSMODG00000003708   Transcript: ENSMODT00000004643
Sequence length 561
Comment pep:novel chromosome:BROADO5:1:385722169:385741303:-1 gene:ENSMODG00000003708 transcript:ENSMODT00000004643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKWWLFMVLLLLGTVVQAHDGHDDEDDDDDEDDDVIDVEEDLEDGIEEVEDSKLGDGV
TFPPSPKVTYKAPVPTGEVYFVDAFDKGMLVGWVLSKAKKDDTDDEIAKYDGKWEVEEMK
ESKLPGDKGLVLLSRAKHHAISARLNKPFTFDTKPLIVQYEVNFQSGIECGGAYVKLLSR
TPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDTDLKTYF
TDKKTHLYTLVLNPDNSFEILVDQMVVNSGNLLNDMTPPVNPPREIEDPNDQKPEDWDER
PKIPDPDAVKPDDWDETAPAKIPDEDATKPEGWLDDEPEYVSDPDAEKPEDWDEDMDGEW
EAPQIANPKCESAPGCGVWQRPTIDNPNYKGKWKAPMIDNPNYQGIWKPRKIPNPDFFED
LEPFKMTPFSAVGLELWSMTSDIFFDNFIICADRAVADDWANDGWGLKKAADGAAEPGVM
GQMLEAAEERPWLWVVYILTVALPLFLVVLFCCSGKKQPSAAEYKKTDAPQPDVKEEEEE
EEKEEEKEKKDEEESEEKLGR
Download sequence
Identical sequences F7FA41
ENSMODP00000004543 ENSMODP00000004543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]