SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004548 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004548
Domain Number 1 Region: 362-595
Classification Level Classification E-value
Superfamily HCP-like 2.7e-48
Family HCP-like 0.00018
Further Details:      
 
Domain Number 2 Region: 569-703
Classification Level Classification E-value
Superfamily HCP-like 6.28e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 202-326
Classification Level Classification E-value
Superfamily HCP-like 9.55e-24
Family HCP-like 0.0034
Further Details:      
 
Domain Number 4 Region: 119-173
Classification Level Classification E-value
Superfamily Kringle-like 4e-20
Family Fibronectin type II module 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004548   Gene: ENSMODG00000003714   Transcript: ENSMODT00000004648
Sequence length 796
Comment pep:novel chromosome:BROADO5:1:239506437:239578107:1 gene:ENSMODG00000003714 transcript:ENSMODT00000004648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMRVRVRLALLLYGALLICGAVWAASDEEGGQDESLDSKTSLPSEETVKDHATAARVVAG
QIFIDSEEPELESPAKEKSFKNQEADVESIIEETSSLEMPNLENKDLEESEEVLKSVLTA
IEGTADGEPCHFPFLFLEKEYAECTSDGREDGRLWCATTYDYKTDEKWGFCETEEQAHKR
RQMQEAEAVYQAGMKILNESSKKTQKKEAYRYLQKAADMNHTKAMEKVSYAFLFGDYLKQ
DVLAAKELFEKLTEEGSPKGQTALGFLYASGLSVNSSQAKALVYYTFGALGGNLIAHMIL
GYRYWAGIGVLQSCESALTHYRLVANHVASDISLTGGTVVQRIRLPDEVENPGMASGMLE
EDLIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLG
KMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVPVNYDLALKYFQKA
AEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHATGTGVMR
SCHTAVELFKNVCERGRWSERLMSAYNSYKDGDSNAAVVQYLLLAEQGYEVAQSNAAFIL
DQKEASIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLA
SEQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLAVVYS
LQYIRDASIREIFSYFDMDQLLGPEWDIYLIIIIALLLGTVIAYRQRQHQAIRRPPGPRP
APPPQQEPRREQQPPQ
Download sequence
Identical sequences F7EWM4
ENSMODP00000004548 ENSMODP00000004548 13616.ENSMODP00000004548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]