SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004569 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004569
Domain Number 1 Region: 1001-1208
Classification Level Classification E-value
Superfamily vWA-like 4.75e-59
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 142-337
Classification Level Classification E-value
Superfamily vWA-like 2.82e-57
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1227-1431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-33
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 4 Region: 447-614
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-20
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 352-440
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-18
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 6 Region: 31-115
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000883
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 740-827
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000246
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 8 Region: 630-712
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000879
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 9 Region: 915-999
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000386
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004569   Gene: ENSMODG00000003690   Transcript: ENSMODT00000004669
Sequence length 1713
Comment pep:novel chromosome:BROADO5:3:393567260:393805182:1 gene:ENSMODG00000003690 transcript:ENSMODT00000004669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSFQGKTWFWLLPVLGAIVHFSSSVKGQVAPPTRLRYNILSHDSIQIQWKAPKGKFSGY
KLLVTPTSGGKTNQLTLQNTANKAIIQGLIPDQTYAVQLIAFDKDKESKPAQGQFRINDL
EKRKEPKPKEPKPKGNGSKPSLPTEGNTFVCKTPAIADIVILVDGSWSIGRFNFRLVRLF
LENLVTAFNVGANKTRIGLAQYSGDPRIEWHLNTFSTKDAVIDAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGARTGVSKIGILITDGKSQDDIIPASKTLRDSGVELFAIGVKNADVA
ELQEIASEPDSTHVYNVAEFDLMHTVVEGLTKTVCTRVEEQEKEIRGSRVTNIGPPTDLV
TSEVAARSFRVTWTPAPGEVEKYRVVYYPTRGGKPEEVVVDGTESTTILKGLMSLTEYQI
AVFAIYSTTASEGLRGTEMTLALPMASNLELYDVTENSLRVRWNAVPGASGYMILYAPLT
EGLAGDEKEMKIGETLTDIQLKGLLPNTEYTVTVYAMFGEEASDPVTGQEMTLPLSPPRN
LRISNVGANSARITWDPTSKNVNGYLISYTTSSGTETNEVEVDGVSTYSLKGLTSLTDYN
VAIFSIYEEGQSEPLMGSFTTKQVPAQQYLEIDEVSEDSFRVSWKPLSLDVAKQKLMWMP
VYGGKVEQVVLNEDQDTYVIEGLQPGTEYEVSLLAVLSDESETEVLSVFGTTLEGPSTIP
PVTTVSPTGPVTTVFRTGIRNLVVDDESTSSLRVKWDISDNRVEQFRVTYLTAKGDHAEE
VIGTVMVPGKQNQLLLKPLLSDTEYKVTVTPIYSDGEGVSVSAPGKTLPLSWGMAEQRVA
YECKNITIRCVWDISVQTVWKHLPIEGWTLISYQKHSKNLKLTSNSTGSLNKEILLIADM
GTALQHIILENLFLGVTDLEAERIQPHSLCVKWKLHSHASAYRVSIEELRDGNKQETALG
GGTSSHCFYGLLADSEHKISVSTQLQEITGPSVSIMERTRPIPTPPPATTTPLPTVPPAK
EVCKAAKADLVFMVDGSWSIGDDNFNKIINFLYNTVGALDKIGVDGTQVSIVQFTDDPRT
EFMLNTYKTKDTLLEGIKNLSYKGGNTKTGKALKHVRDALFTAEGGTRRGIPKVIVVITD
GRSQDDVNKISRELQLEGISIFAIGVADADYAELVSIGSQPSARHVFFVDDFDAFKKIED
ELITFVCETASATCPLVNKDGNSLAGFKMMELFGLVEKDFSAVEGVSMGPGTFNVYPCYQ
LHKDALVSQPTKYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKDSDPLVGVILDN
GGKTITYFNYDYQGEFQTVTFEGPEIKKIFYGSFHKMHIVISKTLAKVFIDCKQVGEKAV
NASGNITSNGVEVLGRMVRSRGPKDNSAPFQLQMFDIVCSTSWASRDKCCELPGLRDEEN
CPALPHTCSCSEISKGASGPVGPPGGPGLRGPKGQRGDQGPKGPDGPRGEAGSPGPQGPP
GPQGPSGLSIQGMPGAPGEKGEKGDLGFPGPQGIPGSTGSPGRDGSQGQRGLPGKDGPTG
PSGPPGPIGIPGAPGVPGITGSTGPQGDLGPPGLPGAKGERGERGDLQSHAMVRAVARQV
CEQLIQSHMARYNSILNQIPSHSSSIRTVPGPPGEPGRQGSPGTPGEQGPPGRPGFPGNP
GQPGTPGERGRLVLNKPMKYNHSLVLSVTALSP
Download sequence
Identical sequences F7EVM1
ENSMODP00000004569 ENSMODP00000004569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]