SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004663 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004663
Domain Number 1 Region: 53-427
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.66e-47
Family Integrin alpha N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 552-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000293
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004663   Gene: ENSMODG00000003807   Transcript: ENSMODT00000004763
Sequence length 622
Comment pep:novel chromosome:BROADO5:1:73075290:73310087:1 gene:ENSMODG00000003807 transcript:ENSMODT00000004763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGADGPMLLRMLPLLLFWFLPPRDGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAV
TDVDHDGDFEIVVAGYNGPNLVLKYDRAQQRLVNIAVDERSSPYYALRDRQGNAIGVTAC
DIDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNGRWEDILSDEVNVRRGVASRFAGRSV
ACVDRTGSGRYSIYIANYANGNVGPDALIEMDPEASDLSRGILALSDVAAEAGVSKYTGG
RGVSVGPILSNSASDIFCDNENGPNFLFHNQGDGTFIDVAASTGVDDPQQHGRGIALADF
NRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIATPKFSMPSPVRTVIAADFDNDQELE
VFFNNIAYRGSSANRLFRVIRREHADPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDL
ILSHGESMAQPLSVFRGNQGFKNNWLRVVPRTQFGAFARGAKVVLYTKKSGAHLRIIDGG
SGYLCEMEPVAHFGLGQDEASSVEVTWPDATLVSRGVASNETNSVLEIPYPREEDGWLKP
ATLECGQGFSQQDNGRCMDTDECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSRGYEPNE
DGTACVVHGQEGIWTPGSFILP
Download sequence
Identical sequences F6ZJ83
XP_007478740.1.35504 ENSMODP00000004663 ENSMODP00000004663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]