SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004671 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004671
Domain Number 1 Region: 156-252
Classification Level Classification E-value
Superfamily S13-like H2TH domain 9.55e-24
Family Middle domain of MutM-like DNA repair proteins 0.019
Further Details:      
 
Domain Number 2 Region: 63-154
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000209
Family N-terminal domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number 3 Region: 320-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000102
Family Ran binding protein zinc finger-like 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004671
Domain Number - Region: 246-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00125
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004671   Gene: ENSMODG00000003813   Transcript: ENSMODT00000004771
Sequence length 565
Comment pep:novel chromosome:BROADO5:5:90224764:90281461:-1 gene:ENSMODG00000003813 transcript:ENSMODT00000004771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCKLNGEKIRTQVRPGQVVTGIRGGAPQPPRVPCPAVCPGASGSLSWTAPLNSNK
DSCWNFPGLLNGCVYSGVETLGKELFMYFGLKALRIHFGMNGFVLINPLKSKNQTKTPPV
FEVQLTKDLICFYDSSVEFRNAMESKQKIRMMEDLDVCSPKFNFSRAENEVKKQKDRMLC
DVLMDQNVLPGIGNIIKNEALFDSGLHPAVKVSQLKDEQTHHLVKMIRDFTIFFYECRKT
GAALYRHYKVYKRSDCGQCSSKITVCRLGENNRMTYFCPRCQKENPHSIDISKLPTRNNL
IGWAYSRGLYSNECVALRAEEEWSCAVCTLINKPSAKECDACMTSRPNDTKKAEDDNNSV
AYDNNLMKYPCNNFVKHHTEVKINRKTAFGMTTLVLTDLSNKSSSLESVRKPNEKPNGGV
QNSPVGHICFNDAQHPSTEKGKATILPLDEVNGSSTFDSQSSLLSPAHKKMKTNHTSPEL
KSYGTEFSSMWNASNSRAKSGSELQVNMTDGTCTKNTDSPRCNKHNRLCVLRVVRKDGES
KGRQFYACPLPKGSQCGFFKVSISI
Download sequence
Identical sequences F6YW89
ENSMODP00000004671 ENSMODP00000004671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]