SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004696 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004696
Domain Number 1 Region: 1085-1191,1253-1533
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.8e-49
Family CPF0428-like 0.085
Further Details:      
 
Domain Number 2 Region: 120-253,459-710
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.82e-40
Family Amylase, catalytic domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004696   Gene: ENSMODG00000003831   Transcript: ENSMODT00000004796
Sequence length 1533
Comment pep:novel chromosome:BROADO5:2:466483352:466558509:1 gene:ENSMODG00000003831 transcript:ENSMODT00000004796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKQVRILLLNDMEKLEKTLFRLEQGFELQFRLGPTLQGKTVTVYTNYPLPGEEFSRQ
KFRPLSWENPTEREDDSDKYCKLNLQKAGSFQYYFNQENEKSGGGYIVVDPILHIGTDNQ
ELHLDCVTLQTYLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLE
LNPDFSKPNKQYTWSDVGQLVEKMKKEWNVLCITDVVYNHTATNSKWIQEHPECAYNLVN
SPHLKPAWVLDRALWHLACDVSEGKYQEKGLPALIENDQQMNCIRKIVWEDIYPKIQLWE
FFQVDVSKSVQQFRALLTQENRKTITKSDPKQLLKIIQDPEYKRLGCTIDMNIALATFIP
HNSGPAAIDECCNWFRKRIEELNAEKLRQMNYHQEQAVNCILGNVFYERLAGHGPKLGPV
TRKHPLVTRYFTFPFGEMTLAEEETLINRPDKSCFFMAHNGWVMGDDPLRNFAEPGSEVY
LRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYM
LDAARKLQPNLYVVAELFTGSEELDNIFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGE
PVGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSSTIVSMACCASGSTRG
YDELIPHQISVVSEERFYTRWNPGASPSNASEVNLQSGIIAARRAINKLHQELGAKGFIQ
VYVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEA
RTVERNTSPYRKDENSINGIPTITVEFKEHIQLNESKIVKQAGVAKKGPNEYVQEIEFEN
LTPGSVIVFRVSLDPHAQVAVGILRSHLTQFNPHFKIGSLPVDNADPILKIPFVSIASKL
NLTDLNQLLYRCDSEEQEDGGGCYEIPNWSPLKYGGLQGLMSVLAEIRPKNDLGHPFCDN
LRSGDWMIDYVSNRLISRSGIIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGVYTTLL
DVAWNQMSSFVQNGSTFVKHLSLGSVQLCGVGKFPSLPLLSPSLPDIPYRLNEVTREKEQ
CCGSLAAGLPHFSSGIFRCWGRDTFIALRGLLLITGRFLDARNIILAFAGTLRHGLIPNL
LGEGTFARFNCRDAVWWWLQCIQDYCKIVPNGTDILKCPVSRMYPTDDSSPLPAGTLDQP
LYEVIQEAMQRHLQGIQFRERNAGPQIDRNMKDEGFNITAGVDDQTGFVFGGNRFNCGTW
MDKMGESDKARNRGIPATPRDGSAVEIVGLSKSAVHWLLELSKRNLFPYHAITIKRNGKD
VKISYEEWNQKIQDHFEKLFHVSEDPSDPNEKHPDLVHKRGIYKDSFGASSPWCDYQLRP
NFTIAMVVAPELFTPKKAWKALEIAEKKLLGTLGMKTLDPDDMVYCGVYDNSLDNENYNL
ARGFNYHQGPEWLWPIGYFLRAKLYFSKLMGQETYSQTVFLVKNILSRHYVHLERSPWKG
LPELTNENGQYCPFSCETQAWSIAAILEVLFDL
Download sequence
Identical sequences F7GJD2
ENSMODP00000004696 XP_001381865.1.35504 XP_007485081.1.35504 XP_016284529.1.35504 ENSMODP00000004696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]